KEGG   Bacillus subtilis subsp. subtilis 168: BSU21950Help
Entry
BSU21950          CDS       T00010                                 

Gene name
ypzA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2564
Motif
Other DBs
NCBI-GeneID: 939078
NCBI-ProteinID: NP_390078
Pasteur: BG13764
BSORF: BG13764
UniProt: O32007
Position
2308495..2308764
Genome map
AA seq 89 aa AA seqDB search
MTSEFHNEDQTGFTDKRQLELAVETAQKTTGAATRGQSKTLVDSAYQAIEDARELSQSEE
LAALDDPEFVKQQQQLLDDSEHQLDEFKE
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcagaatttcataatgaggatcagaccggctttacggataagcggcagctggaa
ctagcggtggaaacagcgcagaaaacaacaggagccgcgacgagaggccaaagcaaaaca
ttagtcgactctgcataccaagccattgaggatgctagagaactgtcacaatctgaagag
ctggcagctctcgatgatcctgaatttgtaaagcagcaacagcagctgctagatgacagc
gagcatcagctggatgaattcaaagaataa

DBGET integrated database retrieval system