KEGG   Bacillus subtilis subsp. subtilis 168: BSU21970Help
Entry
BSU21970          CDS       T00010                                 

Gene name
ypeP
Definition
(RefSeq) hypothetical protein
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU21970 (ypeP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU21970 (ypeP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     BSU21970 (ypeP)
DNA replication proteins [BR:bsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RNase H
    BSU21970 (ypeP)
 Prokaryotic Type
   Elongation factors (bacterial)
    RNase H
     BSU21970 (ypeP)
   Elongation factors (archaeal)
     BSU21970 (ypeP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RVT_3 RNase_H ExbD
Motif
Other DBs
NCBI-GeneID: 939073
NCBI-ProteinID: NP_390080
Pasteur: BG11609
BSORF: BG11609
UniProt: P54164
Position
complement(2308967..2309647)
Genome map
AA seq 226 aa AA seqDB search
MKLRPHLKIEAKGTGSVSFFSEDWLTAQQARTFARELGRFPYMKELEFEDEKGGSWTLKE
LEKLTEELAQEPDDITVYFDGSFDKESELAGLGIVIYYSLGGTRHRLRKNKSFRLKTNNE
AEYAALYEAIREVRELGASRNSITIKGDSLVVLNQLDGSWPCYDPSHNEWLDKIEALLES
LKLTPTYETIQRKDNQEADGLAKKILSHQFVESHTKLDRNGDDDIG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagaccgcatttgaaaatagaagcaaaaggaacgggatccgtctcatttttt
agcgaagactggctgacagcacagcaggcacgtacgttcgccagagaacttggccgtttt
ccatacatgaaggagctagagttcgaagacgagaaaggcggcagctggacgctgaaggaa
ttggaaaagctgacagaggagcttgctcaagagcctgatgacattactgtttattttgac
ggcagtttcgataaagagagcgaactggccggtctcgggatcgtcatctattattcattg
ggaggaacccggcatcgcttgagaaaaaataaaagcttccggctgaaaaccaataatgaa
gctgaatacgcagcgctttatgaagcaataagagaagtaagagagcttggggcaagcaga
aattcaattacaatcaaaggggactcgcttgttgtgctgaatcagcttgacggcagctgg
ccttgttatgatccatctcataatgaatggctggacaaaatagaagcactccttgaatcg
ctgaagcttactccaacctacgaaacaatacaacgaaaagacaatcaggaagctgacggc
ctcgctaaaaaaattctatcccatcaattcgtagaaagccacacgaaattagaccgtaac
ggagatgacgatattggataa

DBGET integrated database retrieval system