KEGG   Bacillus subtilis subsp. subtilis 168: BSU21980
Entry
BSU21980          CDS       T00010                                 

Gene name
ypdP
Definition
(RefSeq) hypothetical protein
  KO
K09125  queuosine precursor transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU21980 (ypdP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU21980 (ypdP)
SSDB
Motif
Pfam: Vut_1 AtpR
Other DBs
NCBI-GeneID: 939075
NCBI-ProteinID: NP_390081
Pasteur: BG11607
BSORF: BG11607
UniProt: P54163 A0A6M4JNI8
Position
2309730..2310419
AA seq 229 aa
MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGN
VMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALET
IFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLRNGGSTAVSQLFDTFIFT
AVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS
NT seq 690 nt   +upstreamnt  +downstreamnt
ttgtttaataattcgttttggatcttttttgcgatcattcattttatcattgttctttta
ttttataaaggatttggcaaaatgggactgtttgtttggatcggttttgcgacagtctgc
gccaacctccaagtcgtcaaaacagtcgaactgtttggcttaacagcgacactcgggaat
gtgatgtatggcacaatcttttttgcgacagatgtgctgaatgaaaaatacggaccagct
gaagccagaaaagcggtatggctcggattctcaacgctcctgacgctgacatttgtcatg
cagggcgtgctgcttttcgaaccggcttccagcgacatatcacaaacagcgctggaaacg
atcttcggattccttccgcgagttgcgttaggaagtctgcttgcctttatcttcagccaa
acgctggatgtttatgtatattcggcaattagaaggatatttccttctgatcggctttta
tggctcagaaacggcggcagtacagcagtcagccagttgtttgatacattcatattcact
gcagtcgcctttctcggcatttatccggcagacgtgtggcttcatatttttatttctaca
tatttgattaagtttgcggtatctttaatttcattgccttatgcctatgcagccaaaaaa
atgatacctaatgatgaaaggagttcataa

DBGET integrated database retrieval system