KEGG   Bacillus subtilis subsp. subtilis 168: BSU21980Help
Entry
BSU21980          CDS       T00010                                 

Gene name
ypdP
Definition
(RefSeq) hypothetical protein
  KO
K09125  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU21980 (ypdP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vut_1
Motif
Other DBs
NCBI-GeneID: 939075
NCBI-ProteinID: NP_390081
Pasteur: BG11607
BSORF: BG11607
UniProt: P54163
Position
2309730..2310419
Genome map
AA seq 229 aa AA seqDB search
MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGN
VMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALET
IFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLRNGGSTAVSQLFDTFIFT
AVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaataattcgttttggatcttttttgcgatcattcattttatcattgttctttta
ttttataaaggatttggcaaaatgggactgtttgtttggatcggttttgcgacagtctgc
gccaacctccaagtcgtcaaaacagtcgaactgtttggcttaacagcgacactcgggaat
gtgatgtatggcacaatcttttttgcgacagatgtgctgaatgaaaaatacggaccagct
gaagccagaaaagcggtatggctcggattctcaacgctcctgacgctgacatttgtcatg
cagggcgtgctgcttttcgaaccggcttccagcgacatatcacaaacagcgctggaaacg
atcttcggattccttccgcgagttgcgttaggaagtctgcttgcctttatcttcagccaa
acgctggatgtttatgtatattcggcaattagaaggatatttccttctgatcggctttta
tggctcagaaacggcggcagtacagcagtcagccagttgtttgatacattcatattcact
gcagtcgcctttctcggcatttatccggcagacgtgtggcttcatatttttatttctaca
tatttgattaagtttgcggtatctttaatttcattgccttatgcctatgcagccaaaaaa
atgatacctaatgatgaaaggagttcataa

DBGET integrated database retrieval system