KEGG   Bacillus subtilis subsp. subtilis 168: BSU22000Help
Entry
BSU22000          CDS       T00010                                 

Gene name
sspL
Definition
(RefSeq) small acid-soluble spore protein L
  KO
K06429  small acid-soluble spore protein L (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU22000 (sspL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2914255
NCBI-ProteinID: YP_054584
Pasteur: BG14176
BSORF: BG14176
UniProt: Q7WY66
Position
2310859..2310987
Genome map
AA seq 42 aa AA seqDB search
MKKKDKGRLTGGVTPQGDLEGNTHNDPKTELEERAKKSNTKR
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagataaaggccggctgaccggcggtgttactccgcaaggcgacctggaa
ggcaatacacataatgaccctaaaacagagcttgaggagagagcaaaaaaaagcaataca
aaacgctag

DBGET integrated database retrieval system