KEGG   Bacillus subtilis subsp. subtilis 168: BSU22000
Entry
BSU22000          CDS       T00010                                 

Gene name
sspL
Definition
(RefSeq) small acid-soluble spore protein L
  KO
K06429  small acid-soluble spore protein L (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU22000 (sspL)
SSDB
Other DBs
NCBI-GeneID: 2914255
NCBI-ProteinID: YP_054584
Pasteur: BG14176
BSORF: BG14176
UniProt: Q7WY66 A0A6M4JIF6
Position
2310859..2310987
AA seq 42 aa
MKKKDKGRLTGGVTPQGDLEGNTHNDPKTELEERAKKSNTKR
NT seq 129 nt   +upstreamnt  +downstreamnt
atgaaaaagaaagataaaggccggctgaccggcggtgttactccgcaaggcgacctggaa
ggcaatacacataatgaccctaaaacagagcttgaggagagagcaaaaaaaagcaataca
aaacgctag

DBGET integrated database retrieval system