KEGG   Bacillus subtilis subsp. subtilis 168: BSU22010
Entry
BSU22010          CDS       T00010                                 

Gene name
exoA
Definition
(RefSeq) 5'-3' exonuclease
  KO
K23786  5'-3' exonuclease [EC:3.1.11.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU22010 (exoA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.-  
     BSU22010 (exoA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BSU22010 (exoA)
SSDB
Motif
Pfam: 5_3_exonuc_N 5_3_exonuc HHH_2 HHH_5
Other DBs
NCBI-GeneID: 939070
NCBI-ProteinID: NP_390083
Pasteur: BG11606
BSORF: BG11606
UniProt: P54161 A0A6M4JIC0
Position
complement(2310995..2311885)
AA seq 296 aa
MNNNKLLLVDGMALLFRAFFATAVHRNFMINDSGVPTNGVNGFLKHLITAVETFQPTHVV
CCWDMGSKTYRNDLFQDYKANRSAPPVELIPQFDLAKEAAAELGIMNIGFAGYEADDCIG
TLADLFANEADITVVTGDRDLLQLLTDKVSVALLQKGIGNYKVYTKETFYEETGVMPKAL
IDIKALMGDSSDNYPGVKGIGEKTAYKLIREYETIDRLLENLSLLPKGQQGKIQQGLSDL
EMSRKLAEIHCSVPLACTLKDALFTLQMEQAADMLRRHQIKGIERMLEKLNAREIV
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaataataataaactattgctggttgacggcatggctcttttattccgggcctttttt
gccacggccgtacatcgcaactttatgataaatgacagcggggtgccgacgaacggcgtc
aacggctttttaaagcatttgattacagctgtggaaacattccagccgacacacgtcgtc
tgctgctgggacatggggagcaaaacgtaccgaaatgacttgttccaagattataaggcc
aaccgcagcgcgccgcctgtggagctgattccgcagtttgatttggcaaaggaagcagcc
gcagagcttggaatcatgaatattggctttgccggctatgaagcggatgactgtatcggt
actcttgccgatttatttgcgaatgaagcggacattacggtggtaacaggggacagagat
ttacttcagctgttaacggataaagtaagcgttgctttgcttcaaaaaggaatcggaaat
tataaagtctatacaaaagagactttttatgaagaaacaggcgtaatgccgaaggctttg
attgatattaaagcgcttatgggtgattccagtgataactatcccggagtcaaaggcatt
ggagaaaaaacagcctacaaactgattcgtgaatacgaaacgattgaccgtttattggaa
aatctttctcttcttccaaaaggacagcagggaaaaattcagcaaggtttaagcgatttg
gagatgtcgaggaagcttgcggaaatccattgctcagtgccgctggcctgcacactgaaa
gacgctttatttactttgcaaatggagcaggcggctgacatgcttcgccgccaccaaatt
aaaggaattgagcgtatgcttgaaaagctgaacgctagagagatcgtttag

DBGET integrated database retrieval system