KEGG   Bacillus subtilis subsp. subtilis 168: BSU22010Help
Entry
BSU22010          CDS       T00010                                 

Gene name
exoA
Definition
(RefSeq) 5'-3' exonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_3_exonuc_N 5_3_exonuc HHH_2 HHH_5
Motif
Other DBs
NCBI-GeneID: 939070
NCBI-ProteinID: NP_390083
Pasteur: BG11606
BSORF: BG11606
UniProt: P54161
Position
complement(2310995..2311885)
Genome map
AA seq 296 aa AA seqDB search
MNNNKLLLVDGMALLFRAFFATAVHRNFMINDSGVPTNGVNGFLKHLITAVETFQPTHVV
CCWDMGSKTYRNDLFQDYKANRSAPPVELIPQFDLAKEAAAELGIMNIGFAGYEADDCIG
TLADLFANEADITVVTGDRDLLQLLTDKVSVALLQKGIGNYKVYTKETFYEETGVMPKAL
IDIKALMGDSSDNYPGVKGIGEKTAYKLIREYETIDRLLENLSLLPKGQQGKIQQGLSDL
EMSRKLAEIHCSVPLACTLKDALFTLQMEQAADMLRRHQIKGIERMLEKLNAREIV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataataataaactattgctggttgacggcatggctcttttattccgggcctttttt
gccacggccgtacatcgcaactttatgataaatgacagcggggtgccgacgaacggcgtc
aacggctttttaaagcatttgattacagctgtggaaacattccagccgacacacgtcgtc
tgctgctgggacatggggagcaaaacgtaccgaaatgacttgttccaagattataaggcc
aaccgcagcgcgccgcctgtggagctgattccgcagtttgatttggcaaaggaagcagcc
gcagagcttggaatcatgaatattggctttgccggctatgaagcggatgactgtatcggt
actcttgccgatttatttgcgaatgaagcggacattacggtggtaacaggggacagagat
ttacttcagctgttaacggataaagtaagcgttgctttgcttcaaaaaggaatcggaaat
tataaagtctatacaaaagagactttttatgaagaaacaggcgtaatgccgaaggctttg
attgatattaaagcgcttatgggtgattccagtgataactatcccggagtcaaaggcatt
ggagaaaaaacagcctacaaactgattcgtgaatacgaaacgattgaccgtttattggaa
aatctttctcttcttccaaaaggacagcagggaaaaattcagcaaggtttaagcgatttg
gagatgtcgaggaagcttgcggaaatccattgctcagtgccgctggcctgcacactgaaa
gacgctttatttactttgcaaatggagcaggcggctgacatgcttcgccgccaccaaatt
aaaggaattgagcgtatgcttgaaaagctgaacgctagagagatcgtttag

DBGET integrated database retrieval system