KEGG   Bacillus subtilis subsp. subtilis 168: BSU22019Help
Entry
BSU22019          CDS       T00010                                 

Gene name
ypzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8302979
NCBI-ProteinID: YP_003097753
UniProt: C0H443
Position
complement(2311986..2312132)
Genome map
AA seq 48 aa AA seqDB search
MLGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRHND
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcagaacaaagctcggaaacagaaatgcacaggcgaataacaacgccaaaaag
aaaaacggatttcaaacccattttgactcttacgcaggacgcgaagctgaaaagctgatc
gccagcaacaaaagacacaacgattga

DBGET integrated database retrieval system