KEGG   Bacillus subtilis subsp. subtilis 168: BSU22020Help
Entry
BSU22020          CDS       T00010                                 

Gene name
ypbS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2533 TBCC_N MTBP_N DUF3892 DNA_pol_A_exoN
Motif
Other DBs
NCBI-GeneID: 939067
NCBI-ProteinID: NP_390084
Pasteur: BG11605
BSORF: BG11605
UniProt: P54160
Position
complement(2312207..2312464)
Genome map
AA seq 85 aa AA seqDB search
MSEVHKAISAHSSKQHEHIKAFMRLENMRELAIEEAVAKCRNDEPYTTDAINEITEQMNQ
LAKKGIVPTRRLVSKEMVREYVSRM
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggtacataaagcaatttcagcacattcatcaaaacagcacgagcatatcaaa
gcatttatgcgtcttgaaaatatgcgtgaattggcgattgaagaagctgttgctaaatgc
agaaacgatgagccttatactacagatgcaattaatgaaattaccgagcaaatgaatcag
ctcgctaaaaaaggcatcgtcccgacaagacggcttgtatcaaaagaaatggtcagagaa
tacgtaagccgcatgtaa

DBGET integrated database retrieval system