KEGG   Bacillus subtilis subsp. subtilis 168: BSU22030Help
Entry
BSU22030          CDS       T00010                                 

Gene name
ypbR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dynamin_N MMR_HSR1 IIGP RsgA_GTPase GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 939071
NCBI-ProteinID: NP_390085
Pasteur: BG11604
BSORF: BG11604
UniProt: P54159
Position
complement(2312529..2316110)
Genome map
AA seq 1193 aa AA seqDB search
MTDQNRKELLHKTGELYKQFIENQDEQRAAKLAAVMKKAADEEVYIAFTGHYSAGKSSLL
NCLLMENILPTSPIPTSANLVVIRNGEKRVRLHTTDGACAELEGTYQKDKVQQYCKDGEQ
IESVEIFDRYTEIDSGVAYIDTPGIDSTDDAHFLSAASILHQADALFYVVHYNHVHAEEN
VKFLRSIKESIPNVYFIVNQIDRHDETETKFGDYQAQVEEMLCNEGISREALYFTSVTEP
DHPFNQMGALREELSRIEQQSKSNMQALTEQKVRNLLKEHTEMLKKDETGAPSFAEQLNI
HTGLVQSLRDQLDEAEKQMTEAEKRMQEEINRILKNANLTPFEMRELAAAFLESQEPSFK
TGFFFSKAKTAQERDKRRNAFFSDVAKRTEAEADWHMIDTLHKLAKVFDVYTAESEKLIQ
AYRTPLDISIIEHAVKHGAAFSSEYVLQYTKDLAELIRKEAKREAADIIKVLSAMVKERV
SKDVQTINDRLVQESEKLVFLQEQARLENNAREKTDRLWAIWEEESACPMHIDTEWFKSK
KTRVAAPEQKQGRSQLTAQPMPKSEIKMEQEMPLQDQIKRFYTLSDILGECSMLLKQTSA
FRERVKRLEERKFTLALFGGFSSGKSSFANALVGERVLPSSPTPTTATINKITKPINGNL
NKTANVVFKTEDDLTAEILQLTGIPKEPAGRSFTEKWEKAVKKNRLQEEHVKLISNFLLA
YEKYQQYIQEQKKLTIPLSELKPYVAEETTACAVKEVTVYYTCPLTEKGITIVDTPGASS
MNKRHTELAFQYIKDADAFFYMTYYQHSFSKGDRSFLRKLGLVKESLSMDKMFFIINAAD
LAKDKTELETVTDYVSAELVKEGVYEPQLFTVSSKEELVGKPESFYNQFSKVRKHLDRFI
EVDVKKASAAQLSSEADKLCETVFQLHQSQHQSREEKEAQKQCLMLSFERTAADIEKRRN
SKTIIEKVKKDTREQLYHIAQRLSYFANDLLKSAFHPGLQNGDWKKNVSKAMTTALHEYL
FEYIQEIKTLDVRMSGFIERHINEEWLDHFQKTLNEDGYFSVYAGDQHSNGIQLKEVEPE
IEERAFEQELKEIKSPKQFFEQKGKATFIEAVRMKLTKITEAWIKNEEESLISHYTAHLR
RLQEDMGEKAIAQITDQKETYLRGYAEGEHAKEIEMAYQACISWKNSDNTIKM
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcaaaacagaaaagagcttttgcataaaaccggggaactttataagcaattt
attgagaatcaagatgaacaaagggctgctaaactggctgcggtcatgaaaaaagcggct
gatgaagaggtttatatcgcgtttaccgggcattattcagcggggaaatcgtcactgctg
aactgcctgttaatggagaatattttgccgacaagcccgattccgacaagcgctaacctt
gttgtgatcagaaacggggaaaagcgagttcggcttcatacaacagacggagcgtgtgct
gagctggaagggacttaccagaaagacaaggtgcagcaatattgtaaagacggggaacag
attgaaagcgtcgaaatttttgacaggtatactgagatcgattccggggttgcgtatatt
gatactccagggatagattcaacagatgatgcgcattttctatcggctgcttctattctt
caccaagcggatgcgctgttttacgtcgttcactataatcacgtgcacgctgaggaaaat
gtaaagtttctcagatcaataaaagaaagcattccgaatgtgtattttatcgtcaatcaa
attgaccgccatgatgagacggagacgaaatttggagactatcaagcgcaggtagaggag
atgctttgcaatgaagggatttcaagggaagcgctctattttacatcagtaacagaaccg
gatcacccgttcaatcagatgggggccctgagagaagagttaagcagaatagaacagcaa
tcaaaaagcaatatgcaggctttaaccgaacaaaaagtccgtaatctgctaaaggaacat
acggaaatgctgaagaaagacgaaacaggcgctccgagtttcgctgaacagcttaatatc
catactggactggtccaatcgctgcgtgatcaattggatgaggccgaaaaacaaatgact
gaggcagagaagaggatgcaggaagaaatcaatcgtattttaaaaaacgccaacctgacg
ccttttgaaatgcgtgaattggcggctgcatttttagaatcacaagagccttcctttaaa
accggctttttcttttctaaagcgaaaactgcacaggaaagagataaaaggcggaatgct
tttttctctgatgtggcaaaacgaacagaggccgaagcggattggcatatgatagacacg
cttcataaactcgccaaggtatttgatgtctataccgctgaaagtgaaaagctgattcag
gcctatcgcacaccgcttgatataagcatcattgaacacgcggtcaagcatggtgcagcc
ttttcctctgaatatgtattgcaatatacaaaagacttggcagagctcatccggaaagag
gcgaaaagagaagccgcagacatcataaaggtgctctccgctatggtgaaagagcgtgtt
tccaaagatgtgcaaacaattaacgaccggctcgtccaagaatcagaaaaacttgtcttt
cttcaagaacaggcacgtttagagaataatgcccgagagaaaaccgatcgcctgtgggcc
atttgggaagaagagtccgcatgcccaatgcatatagacacagaatggtttaaatcgaag
aaaacaagagtggcggctccagagcagaaacaaggccgaagccagctgacggcgcagccg
atgccgaaatcagaaatcaaaatggaacaagaaatgccgcttcaagaccaaatcaaacgc
ttttacactttgtctgacattttaggcgaatgcagcatgttgttaaagcaaacttcagcg
tttcgtgaaagggtgaaaaggcttgaggaacggaaatttacactcgctctttttggaggc
tttagctcggggaaatcatcatttgccaatgcgcttgtcggcgaaagagtgctgccatcc
tcaccaacgccaaccacagcgacaattaacaagatcacaaagccaatcaatggcaactta
aacaaaacagcgaatgtagtgtttaagacagaggatgacttaacggctgaaattttgcag
ctcaccggaataccaaaggagccggcaggccgttccttcacagagaagtgggaaaaggca
gtcaaaaaaaacaggctgcaggaagaacacgtgaaattgatcagcaatttcctgcttgca
tacgagaagtatcagcagtatatacaggaacagaagaaattaacgattccgctctctgaa
ttaaagccgtatgtagcagaggaaacaacggcctgtgctgtgaaagaggtaacggtctac
tatacatgcccgctcactgaaaaagggattacgatcgttgatacacccggcgcgagcagc
atgaataaacggcatacagaactggcattccaatatatcaaagatgctgatgcatttttt
tatatgacttattatcagcactctttttcaaaaggagaccgttcatttttgcgaaagctt
ggacttgtgaaagaatcgctcagcatggataaaatgttttttattattaatgctgcagac
cttgcaaaagataaaacagagctcgaaacagtgaccgattatgtcagcgcagagcttgta
aaagaaggggtttatgagccgcagctctttaccgtatcaagtaaggaggaactggtggga
aaaccggagtcattttataatcagttctcgaaagtaagaaaacacttagaccggtttatc
gaagtggatgtaaaaaaagcgtcagcagcgcagctcagttcggaggcagacaaactatgc
gaaactgtttttcagcttcaccaatcccagcatcagtcccgagaagagaaggaagcgcag
aaacagtgccttatgctgtcatttgagcggacagcggccgatatcgagaaacggcggaac
tcaaaaaccatcattgaaaaagtaaaaaaagatacaagagagcagctatatcacattgca
cagcgattatcatattttgcaaatgatttattaaaatcggcatttcatcccgggctgcaa
aacggggattggaaaaagaacgtcagtaaagcgatgacaacagccttacatgaatatcta
tttgaatatattcaggaaatcaaaacgcttgatgttcgcatgagcggtttcatcgaacgg
catatcaatgaagaatggctggatcattttcaaaaaacattaaacgaggacggttatttt
tccgtttatgcgggtgatcagcattcgaacggcatacagttgaaggaagttgaaccggaa
atagaagaacgtgcttttgagcaggaactaaaagagatcaaatcaccgaagcagtttttt
gagcagaaaggaaaagcgacctttatcgaagctgtacggatgaaacttacgaaaatcaca
gaggcatggataaaaaatgaagaagaaagcctgatatctcattacactgctcacctcaga
cgcttacaggaagatatgggtgaaaaagcaatcgcgcaaataacggatcaaaaagagaca
tatttaagaggatatgcggaaggggaacatgcgaaagagattgaaatggcgtatcaggcg
tgcatctcctggaaaaattcagacaatacaataaaaatgtaa

DBGET integrated database retrieval system