KEGG   Bacillus subtilis subsp. subtilis 168: BSU22040
Entry
BSU22040          CDS       T00010                                 

Gene name
ypbQ
Definition
(RefSeq) hypothetical protein
  KO
K16168  methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU22040 (ypbQ)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  Methylase
   BSU22040 (ypbQ)
SSDB
Motif
Pfam: ICMT PEMT DUF4064 TMEM70
Other DBs
NCBI-GeneID: 939072
NCBI-ProteinID: NP_390086
Pasteur: BG11603
BSORF: BG11603
UniProt: P54158 A0A6M3ZDI3
Position
complement(2316446..2316952)
AA seq 168 aa
MFWLLIAILIVQRAAEMAVARQNEQKVKKQGAIEFGESHYPYIITMHILFFLSLIAEVLL
MNKQPSSWWLGIAAVILSVQIVRYWALCSLGAYWNTKILVVPGVELVKKGPYKWMKHPNY
AVVILEILLIPLLYQAYVTMCLFSIFNAVLLSVRIRAEDKALQEYSVK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttttggttgttgatcgccattctcattgttcaaagagcagcagaaatggcagtggcc
aggcaaaacgaacaaaaggtaaagaagcaaggagcaattgaatttggcgagagccactat
ccgtatatcattacgatgcatatcctttttttcctgtccttaattgccgaggtgctgctg
atgaataaacagccgtccagctggtggctcggtatcgctgcagtgattttaagcgtacag
atcgtacggtattgggcgctttgttccttaggagcatattggaatacgaaaatccttgtt
gttccaggtgtagagcttgtaaaaaaaggtccatataaatggatgaaacatccaaactat
gccgttgttatcctcgaaattttgctgattccgctgctttatcaagcatacgtcaccatg
tgtctgttttccattttcaatgccgtgttgttaagcgtcagaattcgcgcagaagacaaa
gcattacaggaatacagcgtaaaatag

DBGET integrated database retrieval system