KEGG   Bacillus subtilis subsp. subtilis 168: BSU22050Help
Entry
BSU22050          CDS       T00010                                 

Gene name
bcsA
Definition
(RefSeq) chalcone synthase
  KO
K16167  alkylresorcinol/alkylpyrone synthase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU22050 (bcsA)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Type III PKS
   Bacterial type
    BSU22050 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C FAE1_CUT1_RppA ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 939069
NCBI-ProteinID: NP_390087
Pasteur: BG11523
BSORF: BG11523
UniProt: P54157
Position
complement(2316956..2318053)
Genome map
AA seq 365 aa AA seqDB search
MAFILSIGTSLPAYNVNQEKAAEFARYMFQHSFKDIDRLLSSFKNGQIHSRQFVKPIEWY
KEGHSFEEKNQIYIEETLKHSRAAVRECLSHPEFFQEAIPYEKVEAVFFVSSTGLSTPSI
EARLMNELPFSPYTKRIPIWGLGCAGGASGLARAAEYCKAYPEAFVLVISAELCSLTFQP
EDKTKSNLIGTSLFGDGIAAALLCGEKADRRVSKLKLAPKIMDAQSVLMKQSEDVMGWDF
TDQGFKVIFSRDIPTLVEKWLKTNVQIFLDKHKLSFHDISVFLAHPGGKKVIDAYIKSLG
LSSEKLSSAQSILQKHGNMSSATILYVIKDHLQNGHKKEAERGLIGALGPGFSSELLLFS
WEKGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttattttatccattggaacaagtcttcctgcgtataatgtaaaccaagagaaa
gcggccgagttcgcccgctatatgtttcagcattcttttaaggatattgacaggctgtta
tcctcctttaaaaacgggcaaatccattcgagacagtttgttaagccgattgaatggtat
aaagaggggcacagctttgaagaaaaaaatcaaatatacatagaagaaacacttaaacac
agcagagcggctgttcgtgagtgcctctctcatccggaattttttcaagaagccattcct
tatgagaaagtggaagctgtttttttcgtctccagtacaggtctttccacaccgagtatc
gaggcgcggcttatgaatgaacttccgttttctccatatacgaagcggattccgatttgg
gggcttggctgtgcaggaggagccagcggacttgcgcgtgcagccgaatactgcaaagcg
tatcctgaggcttttgtgcttgtcatttctgccgagctgtgcagcctgacattccagccg
gaagataaaacaaaaagcaatctgatcggcacctcgctttttggtgacggcattgccgca
gctttattatgcggagagaaggcggaccgcagggtgtcaaagctgaagcttgcgccgaag
ataatggacgcccaatctgttttgatgaaacaatcagaagatgtcatgggctgggacttt
accgatcaaggattcaaagtcattttctcacgagacattccgaccttggtggaaaaatgg
ctcaaaacaaatgtacagatttttttggacaaacataagctgtcattccatgatatcagt
gtttttttggcgcatccaggcggaaaaaaagtgatcgatgcatacatcaaaagtctcggg
ctgtcgtcagaaaagctttcatctgcgcaaagcattttgcaaaagcacggaaatatgtct
tcagccacaatcttgtatgtgatcaaagaccatctgcagaacggacataaaaaggaagct
gaacgaggactgattggcgcattagggccgggtttctcatcagagttgctattattcagc
tgggaaaagggggcctga

DBGET integrated database retrieval system