KEGG   Bacillus subtilis subsp. subtilis 168: BSU22060
Entry
BSU22060          CDS       T00010                                 

Gene name
pbuX
Definition
(RefSeq) xanthine permease
  KO
K16169  xanthine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU22060 (pbuX)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU22060 (pbuX)
SSDB
Motif
Pfam: Xan_ur_permease MFS_MOT1
Other DBs
NCBI-GeneID: 939068
NCBI-ProteinID: NP_390088
Pasteur: BG11080
BSORF: BG11080
UniProt: P42086 A0A6M4JIK2
Position
complement(2318127..2319443)
AA seq 438 aa
MRNGFGKTLSLGIQHVLAMYAGAIVVPLIVGKAMGLTVEQLTYLVSIDIFMCGVATLLQV
WSNRFFGIGLPVVLGCTFTAVSPMIAIGSEYGVSTVYGSIIASGILVILISFFFGKLVSF
FPPVVTGSVVTIIGITLMPVAMNNMAGGEGSADFGDLSNLALAFTVLSIIVLLYRFTKGF
IKSVSILIGILIGTFIAYFMGKVQFDNVSDAAVVQMIQPFYFGAPSFHAAPIITMSIVAI
VSLVESTGVYFALGDLTNRRLTEIDLSKGYRAEGLAVLLGGIFNAFPYTAFSQNVGLVQL
TGIKKNAVIVVTGVILMAFGLFPKIAAFTTIIPSAVLGGAMVAMFGMVIAYGIKMLSRID
FAKQENLLIVACSVGLGLGVTVVPDIFKQLPSALTLLTTNGIVAGSFTAVVLNIVYNVFS
KAKKIEQEADLAEQKTAV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagaaatggattcggcaaaacgctgtctttagggattcagcatgttcttgccatgtat
gccggcgccattgtcgttcctctgattgtcggaaaagcaatgggactgactgtcgagcag
ctgacttacttagtatcgattgatatttttatgtgcggtgtggctacacttctgcaagtg
tggagcaaccgattttttgggatcgggcttccggtagtgcttggctgtacctttacagct
gtatcgccgatgatagcgattggatctgaatatggggtttcaacagtttacggcagcatt
atcgcttcaggcattcttgtcattcttatttcatttttctttggaaagctcgtatcgttt
tttccgccggtcgtgacaggctctgttgttacgattatcggtattacactgatgccggtt
gccatgaataacatggccggcggagaaggaagtgcagatttcggagatctctccaatctt
gcacttgcttttaccgtgttgagtatcattgtgcttctataccgttttacaaaaggcttt
atcaagtccgtctcgattttgatcggtattttgattggcaccttcatcgcatattttatg
ggaaaagttcaatttgataatgtttcggacgcggcagttgttcaaatgattcagccattt
tacttcggagcgccgtcttttcacgcagcgcctatcattacgatgtccatcgttgcaatt
gtcagccttgtggagtcaactggtgtttactttgctttaggtgacctgacaaaccgccgt
ttgacagagatagatttgtctaaaggctatcgagctgaaggactggctgtgcttctgggc
ggtatttttaacgcttttccttacacggcattctctcaaaatgtcgggcttgttcagctc
acagggatcaaaaaaaatgccgtcattgtggtcacaggtgtgatcctaatggcatttggg
ctgtttccaaagatcgctgctttcacgactattattccatccgctgttttgggcggtgca
atggtggcgatgtttggaatggtgattgcttacggaattaaaatgctcagccgcattgat
tttgcgaaacaggaaaatctgctgattgttgcttgctcagtgggattggggctcggtgtg
accgttgtgccggatattttcaaacagcttccgagtgccttaacgctgcttacaacgaat
ggcattgtggcgggcagctttactgcagtcgtcttaaatattgtatataacgttttttct
aaagctaaaaaaatagaacaagaagctgacctcgctgaacaaaaaacagcagtctaa

DBGET integrated database retrieval system