KEGG   Bacillus subtilis subsp. subtilis 168: BSU22070Help
Entry
BSU22070          CDS       T00010                                 

Gene name
xpt
Definition
(RefSeq) xanthine phosphoribosyltransferase
  KO
K03816  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU22070 (xpt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     BSU22070 (xpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran
Motif
Other DBs
NCBI-GeneID: 939064
NCBI-ProteinID: NP_390089
Pasteur: BG11079
BSORF: BG11079
UniProt: P42085
Structure
PDB: 

Position
complement(2319440..2320024)
Genome map
AA seq 194 aa AA seqDB search
MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESS
GIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHV
LIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQS
LEEGKVSFVQEVHS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaagcactgaaacggaaaatagaggaagaaggcgtcgtattatctgatcaggtattg
aaagtggattcttttttgaatcaccaaattgatccgctgcttatgcagagaattggtgat
gaatttgcgtctaggtttgcaaaagacggtattaccaaaattgtgacaatcgaatcatca
ggtatcgctcccgctgtaatgacgggcttgaagctgggtgtgccagttgtcttcgcgaga
aagcataaatcgttaacactcaccgacaacttgctgacagcgtctgtttattcctttacg
aagcaaacagaaagccaaatcgcagtgtctgggacccacctgtcggatcaggatcatgtg
ctgattatcgatgattttttggcaaatggacaggcagcgcacgggcttgtgtcgattgtg
aagcaagcgggagcttctattgcgggaatcggcattgttattgaaaagtcatttcagccg
ggaagagatgaacttgtaaaactgggctaccgagtggaatctttggcaagaattcagtct
ttagaagaaggaaaagtgtccttcgtacaggaggttcattcatga

DBGET integrated database retrieval system