KEGG   Bacillus subtilis subsp. subtilis 168: BSU22080Help
Entry
BSU22080          CDS       T00010                                 

Gene name
ypwA
Definition
(RefSeq) metalloprotease YpwA
  KO
K01299  carboxypeptidase Taq [EC:3.4.17.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU22080 (ypwA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.19  carboxypeptidase Taq
     BSU22080 (ypwA)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M32: carboxypeptidase Taq family
   BSU22080 (ypwA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 939061
NCBI-ProteinID: NP_390090
Pasteur: BG11458
BSORF: BG11458
UniProt: P50848
Structure
PDB: 

Position
complement(2320355..2321860)
Genome map
AA seq 501 aa AA seqDB search
MEIHTYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAESIGQLSTDIFNIQTS
DRMKELIDVLYERFDDLSEDTKKAVELAKKEYEENKKIPEAEYKEYVILCSKAETAWEEA
KGKSDFSLFSPYLEQLIEFNKRFITYWGYQEHPYDALLDLFEPGVTVKVLDQLFAELKEA
IIPLVKQVTASGNKPDTSFITKAFPKEKQKELSLYFLQELGYDFDGGRLDETVHPFATTL
NRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLF
YENFIGRNKHFWTPYYKKIQEASPVQFKDISLDDFVRAINESKPSFIRVEADELTYPLHI
IIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTDAEGILQDVHWAGGDFGYFPSY
ALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLTEKVHIHGKRKKPLDIIKDATGE
ELNVRYLIDYLSNKYSNLYLL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagatacatacatatgaaaaagaattttttgatcttttaaaaagaatctcacattac
agcgaagcagttgcgttaatgcactgggactccagaacaggcgcgccgaaaaatggctca
gaggatcgtgccgaaagtatcggccagctttcaacagatatattcaatatccaaacatca
gatcgaatgaaggagcttatcgatgtcctgtatgaacgatttgatgacttgtcggaagat
acgaaaaaagcagtggaactggcgaaaaaagagtatgaagagaataagaaaatccctgag
gctgaatacaaagaatacgtgattctgtgttcaaaggcagaaacagcgtgggaggaagcg
aaaggaaaatctgatttcagcttgttttctccttatttagaacagctgattgaattcaat
aaacgttttattacgtattggggatatcaagagcatccttatgatgcattgcttgatttg
tttgagcccggcgtcacggtaaaggtgcttgatcagttgtttgctgagctgaaggaagcg
attatccctcttgttaaacaggtgacagcttccggaaataaaccagatacaagctttatt
acaaaagcgttcccgaaagaaaagcaaaaagagctcagtctgtattttttacaggagctt
ggctacgattttgatggcggaagacttgatgaaaccgttcatccgtttgcaactacgctg
aatcggggagacgttcgggtcacgacgagatatgatgaaaaagatttccggacggcgatc
tttgggaccattcatgagtgcgggcacgcgatttacgagcaaaatattgatgaagcactc
agtggcacgaacttgtcagacggcgcatcgatgggaattcatgaatcgcaatcattattt
tacgagaattttatcggccgcaacaagcatttttggactccgtactataagaagattcaa
gaggcatcacctgtacagttcaaggacatctccctggatgattttgtccgggcaatcaat
gaatcaaaaccttcatttatcagggtcgaagcggatgaattgacgtatcctcttcatatc
atcatccgttatgaaattgaaaaagcgattttcagcaatgaagtgtctgtggaagatctg
ccgtcgctttggaatcaaaaataccaggattatttagggattacaccgcagaccgacgca
gaggggattttacaggacgtccattgggcaggtggagatttcggctacttcccatcctat
gcgctcggctacatgtatgcggctcagctgaaacaaaaaatgcttgaggatctccctgaa
tttgacgctctcttggaaagaggagagttccatccgataaagcaatggctgacggaaaag
gtgcacattcacggaaaacggaaaaagccgttagacattattaaagatgcaacaggagaa
gagctgaatgttcgctatttaattgattatttatcaaacaaatattcaaatctctatctg
ttataa

DBGET integrated database retrieval system