KEGG   Bacillus subtilis subsp. subtilis 168: BSU22090Help
Entry
BSU22090          CDS       T00010                                 

Gene name
kdgT
Definition
(RefSeq) 2-keto-3-deoxygluconate permease
  KO
K02526  2-keto-3-deoxygluconate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU22090 (kdgT)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU22090 (kdgT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdgT DUF3334
Motif
Other DBs
NCBI-GeneID: 939065
NCBI-ProteinID: NP_390091
Pasteur: BG11399
BSORF: BG11399
UniProt: P50847
Position
complement(2321972..2322964)
Genome map
AA seq 330 aa AA seqDB search
MKIKATIERVPGGMMIIPLFLGAALNTFAPGTAEFFGGFTGALITGTLPILGVFIFCVGA
TIDFRSSGYIARKGITLLLGKIGFAALLGVIAAQFIPDDGIQSGFFAGLSVLAIVAVMNE
TNGGLYLALMNHMGRKEDAGAFAFISTESGPFMTMVTFGVTGLAAFPWETLAATVIPFLL
GCILGNLDHDLRDLFSKVVPAIIPFFAFSLGNTLNFGMLIQSGLLGIFIGVSVVILSGSS
LFLLDRFIARGDGVAGVAASSTAGAAVAVPYALAEANASFAPVAESATAIIATSVIVTSL
LTPLATVWVDKKIKQKKRRTPPPKNQMTIN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaggcgacaattgaacgggtacctggcggaatgatgattattccgctattt
cttggagcggcgctcaacacgtttgcgcctggaacagcggagttctttggagggtttacg
ggtgctttgattaccggaacgctgccgatactgggtgtttttatcttttgcgtaggagca
acgattgattttcgttcttcaggctatatcgcaagaaaaggaatcacgttattattgggg
aagatcggatttgcggcgctgctcggcgtgatcgcagcgcaatttatacctgacgatggc
atacaatccggcttttttgcaggcctttctgttttagcaattgtcgcggtaatgaatgaa
acgaacggcggactgtatttggcgctcatgaatcacatgggaagaaaagaggatgcgggc
gctttcgcctttatcagtacagaatctggtccttttatgaccatggtgacgtttggtgtg
acgggacttgccgcattcccatgggaaacgctggcagcgacagtcatcccgtttttactt
ggatgtatacttggaaatctggatcatgatctcagagacttattcagcaaggttgtgccg
gcgatcattccatttttcgccttttcgctcggcaataccttgaattttggaatgctgatc
caatcagggctgctcggcatttttatcggagtttctgtcgtcattttatcgggcagttct
ttgtttttgcttgatcgttttattgcgcggggagatggtgtcgcgggagtggccgcttct
tctacggcaggggcggctgtagccgtgccatatgcattagcggaagcgaatgcctcattt
gcgccagttgctgagtcggcaactgcaattatcgcgacaagcgttattgtcacctcgctc
ttaaccccgctggcaacagtgtgggtagataaaaaaatcaagcagaaaaagcggagaaca
cctccgccaaaaaatcaaatgacgatcaactga

DBGET integrated database retrieval system