KEGG   Bacillus subtilis subsp. subtilis 168: BSU22100Help
Entry
BSU22100          CDS       T00010                                 

Gene name
kdgA
Definition
(RefSeq) KHG/KDPG aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU22100 (kdgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU22100 (kdgA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     BSU22100 (kdgA)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     BSU22100 (kdgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase
Motif
Other DBs
NCBI-GeneID: 939066
NCBI-ProteinID: NP_390092
Pasteur: BG11396
BSORF: BG11396
UniProt: P50846
Position
complement(2323009..2323599)
Genome map
AA seq 196 aa AA seqDB search
MESKVVENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIESFRN
REDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIME
ALTFGFTTLKLFPSGVFGIPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGS
QLGSCSKEDLQAVFQV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggagtccaaagtcgttgaaaaccgtctgaaagaagcaaagctgattgcagtcattcgt
tcaaaggataagcaggaggcctgtcagcagattgagagtttattagataaagggattcgt
gcagttgaagtgacgtatacgacccccggggcatcagatattatcgaatccttccgtaat
agggaagatattttaattggcgcgggtacggtcatcagcgcgcagcaagctggggaagct
gctaaggctggcgcgcagtttattgtcagtccgggtttttcagctgatcttgctgaacat
ctatcttttgtaaagacacattatatccccggcgtcttgactccgagcgaaattatggaa
gcgctgacattcggttttacgacattaaagctgttcccaagcggtgtgtttggcattccg
tttatgaaaaatttagcgggtcctttcccgcaggtgacctttattccgacaggcgggata
catccgtctgaagtgcctgattggcttagagccggagctggcgccgtcggagtcggcagc
cagttgggcagctgttcaaaagaggatttgcaggctgttttccaagtgtaa

DBGET integrated database retrieval system