KEGG   Bacillus subtilis subsp. subtilis 168: BSU22110Help
Entry
BSU22110          CDS       T00010                                 

Gene name
kdgK
Definition
(RefSeq) 2-dehydro-3-deoxygluconokinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU22110 (kdgK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     BSU22110 (kdgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 939058
NCBI-ProteinID: NP_390093
Pasteur: BG11397
BSORF: BG11397
UniProt: P50845
Position
complement(2323601..2324575)
Genome map
AA seq 324 aa AA seqDB search
MKLDAVTFGESMAMFYANEYGGLHEVSTFSKGLAGAESNVACGLARLGFRMGWMSKVGND
QLGTFILQELKKEGVDVSRVIRSQDENPTGLLLKSKVKEGDPQVTYYRKNSAASTLTTAE
YPRDYFQCAGHLHVTGIPPALSAEMKDFTYHVMNDMRNAGKTISFDPNVRPSLWPDQATM
VHTINDLAGLADWFFPGIAEGELLTGEKTPEGIADYYLKKGASFVAIKLGKEGAYFKTGT
SEGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLSYKDAVQRGNAIGALQVQAPGDMDG
LPTREKLASFLSAQRTVHQKKGDY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgatgcggtgacattcggggaatcaatggccatgttttatgcaaatgagtat
ggaggccttcatgaagtatccactttttctaaagggcttgccggagcagaaagcaatgtc
gcctgcggccttgccagactcggatttcgaatgggatggatgagcaaggtcggcaatgat
cagctcggaacgtttattttacaagagcttaaaaaagagggagtggatgtgtcccgcgtg
atccgctcgcaggacgaaaatcccaccgggctgctgctgaagtcaaaagtgaaagaaggc
gacccgcaagttacctactataggaaaaactcagctgcaagcacattaactacagctgaa
tatccgagagattattttcaatgcgcaggccatttgcatgtgacaggtattccgcctgct
ttatcagccgagatgaaagacttcacgtatcatgtcatgaacgacatgagaaacgcaggg
aagaccatttcattcgaccctaatgtaagaccttcgctttggcctgatcaagcaacaatg
gtacacacaatcaatgatctggctgggcttgcagactggtttttcccgggtatcgcagag
ggagagctattgaccggagaaaaaacacctgaaggcattgccgactattatttgaaaaaa
ggtgccagctttgttgctattaaacttggaaaagaaggcgcttactttaaaacggggaca
agtgaaggatttctagaaggctgccgggtcgaccgggtggttgatacggtcggcgccgga
gacggatttgcagtcggtgtaatcagcggtatcctagacggtttgtcgtacaaggatgcg
gtgcaaaggggaaatgcgattggcgctttgcaagtgcaggcaccgggggatatggacggt
ttgccgaccagggagaaattagcttcttttttatctgctcaaagaacggttcaccaaaag
aaaggggattattaa

DBGET integrated database retrieval system