KEGG   Bacillus subtilis subsp. subtilis 168: BSU22130Help
Entry
BSU22130          CDS       T00010                                 

Gene name
kduI
Definition
(RefSeq) 5-keto-4-deoxyuronate isomerase
  KO
K01815  4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU22130 (kduI)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.17  5-dehydro-4-deoxy-D-glucuronate isomerase
     BSU22130 (kduI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KduI
Motif
Other DBs
NCBI-GeneID: 939062
NCBI-ProteinID: NP_390095
Pasteur: BG11401
BSORF: BG11401
UniProt: P50843
Position
2325854..2326681
Genome map
AA seq 275 aa AA seqDB search
MENRYSVHPEQVKRFTTEELRSHFLMDSLFTENKLTMYYSHEDRVVIGGAAPGQSELKLD
AGDFLKTDFFLERREIGIINVGQPGAVRVGDDEYVLQTKDFLYIGMGNQDVSFSSLNGEK
AKFYFVSACAHKSYPTQKAALSELTPDRLGDDAASNVRSLYKVIHQDGIKSCQLMMGITM
LDQNNNWNTMPAHVHDRRMEAYLYLDLEKDSKVFHFMGQPDETRHLVVGNEQAVLSPAWS
IHSGAGTSNYSFVWAMAGENYTFTDMDLIPMDGLK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcgttattctgtacatcctgaacaagtaaaacgctttacaacagaggagctt
cgcagtcatttcttaatggattctttatttacagaaaacaaacttacgatgtattactca
catgaagaccgggttgtcatcggcggagcggctccagggcaaagtgaactgaagcttgat
gcaggtgattttctaaaaacagacttctttttggaacggcgtgaaatcgggattattaat
gtcggccagcctggtgccgttagagtcggcgatgatgaatatgtgcttcaaacaaaggat
tttctctatattggaatgggcaatcaggatgtatcgttttcaagcctgaacggggaaaaa
gcgaagttttacttcgtctccgcttgcgcccacaaaagctatccgacacaaaaagccgcc
ctatctgaactgacaccggaccgccttggtgatgatgcagcgtctaatgtcagaagtctg
tacaaagtcattcatcaggatggcattaaaagctgtcagctgatgatgggaataacgatg
ttagatcaaaacaacaactggaataccatgccagcacacgttcatgaccgtcggatggag
gcttatctttatctggatcttgaaaaggactcaaaggtatttcatttcatgggccagccg
gacgaaacacgccatcttgttgttggaaatgagcaggctgtcctttctcccgcttggtct
attcattctggcgcaggaacatcaaactatagctttgtgtgggcgatggctggagaaaat
tacacatttacggacatggatctcattccaatggatgggctgaaataa

DBGET integrated database retrieval system