KEGG   Bacillus subtilis subsp. subtilis 168: BSU22140Help
Entry
BSU22140          CDS       T00010                                 

Gene name
kduD
Definition
(RefSeq) 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
  KO
K00065  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase [EC:1.1.1.127]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU22140 (kduD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.127  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
     BSU22140 (kduD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 939059
NCBI-ProteinID: NP_390096
Pasteur: BG11400
BSORF: BG11400
UniProt: P50842
Position
2326683..2327447
Genome map
AA seq 254 aa AA seqDB search
MGYLHDAFSLKGKTALVTGPGTGIGQGIAKALAGAGADIIGTSHTSSLSETQQLVEQEGR
IFTSFTLDMSKPEAIKDSAAELFENRQIDILVNNAGIIHREKAEDFPEENWQHVLNVNLN
SLFILTQLAGRHMLKRGHGKIINIASLLSFQGGILVPAYTASKHAVAGLTKSFANEWAAS
GIQVNAIAPGYISTANTKPIRDDEKRNEDILKRIPAGRWGQADDIGGTAVFLASRASDYV
NGHILAVDGGWLSR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggttatctacatgacgccttttcattaaaaggaaaaacagcgctggtgacaggcccg
ggaacagggatcggtcaaggaatagccaaagccctagccggggctggcgctgatattatc
ggcacatcacatacaagcagtctgtctgaaacacagcagcttgtggaacaggaaggccgg
atatttacatcttttacattggacatgagcaagccggaagcgataaaggattctgcagct
gagctgtttgaaaacaggcagatcgacatccttgtcaataatgccggcattattcatcgg
gaaaaagcggaagattttccagaagagaactggcagcacgtactgaatgtcaatctaaac
agcctgtttattctgacacagcttgctggcaggcacatgctgaaaagaggtcatggaaag
attattaatattgcctctctcctgtcttttcaaggcggcatcctcgttccggcttacacc
gcgagcaaacacgctgttgccggtttgacaaaatcatttgcaaatgagtgggcagcgtca
ggtattcaggtcaacgcaatcgccccaggctatatttctactgcgaatacaaagcctatt
cgggatgacgaaaagcgaaatgaggacattttaaagagaattcctgccggccgctggggc
caagcggatgatatcggggggactgcagtctttttggcatcacgtgcttcagattatgta
aatggacatattttagcagttgatggcggctggctatcccgctga

DBGET integrated database retrieval system