KEGG   Bacillus subtilis subsp. subtilis 168: BSU22160Help
Entry
BSU22160          CDS       T00010                                 

Gene name
yptA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939055
NCBI-ProteinID: NP_390098
Pasteur: BG11456
BSORF: BG11456
UniProt: P50841
Position
complement(2329515..2329706)
Genome map
AA seq 63 aa AA seqDB search
MLNSEHFNLIQRALDATANELKELGTDSSPSVISHAQTDLEKAVEHIYSTDHPFLSSHVI
NRK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacagcgaacattttaatcttattcaaagggcgcttgacgcaacagcaaacgag
ctgaaggagctcgggactgattcgtctccgtctgtgatttcgcatgcgcaaactgattta
gaaaaagcggtagaacatatttattcaacagaccatccttttttatcgtcgcatgtgatc
aatcgtaagtaa

DBGET integrated database retrieval system