KEGG   Bacillus subtilis subsp. subtilis 168: BSU22169
Entry
BSU22169          CDS       T00010                                 

Gene name
ypzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YpzG
Other DBs
NCBI-GeneID: 8303061
NCBI-ProteinID: YP_003097754
UniProt: C0H444 A0A6M3ZD00
Position
2329870..2330022
AA seq 50 aa
MSYRNRLDQHSELFHHNWTRPKRSKSQVNGHTEMSQTNIILRSNAKAHRW
NT seq 153 nt   +upstreamnt  +downstreamnt
atgagttatagaaaccgattagatcagcattctgaactgtttcatcacaattggacgcgg
cctaaacgttcaaagtctcaagtaaacggtcacactgaaatgtcccaaaccaacattata
ttgagaagcaacgcgaaagctcaccgttggtaa

DBGET integrated database retrieval system