KEGG   Bacillus subtilis subsp. subtilis 168: BSU22169Help
Entry
BSU22169          CDS       T00010                                 

Gene name
ypzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YpzG
Motif
Other DBs
NCBI-GeneID: 8303061
NCBI-ProteinID: YP_003097754
UniProt: C0H444
Position
2329870..2330022
Genome map
AA seq 50 aa AA seqDB search
MSYRNRLDQHSELFHHNWTRPKRSKSQVNGHTEMSQTNIILRSNAKAHRW
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgagttatagaaaccgattagatcagcattctgaactgtttcatcacaattggacgcgg
cctaaacgttcaaagtctcaagtaaacggtcacactgaaatgtcccaaaccaacattata
ttgagaagcaacgcgaaagctcaccgttggtaa

DBGET integrated database retrieval system