KEGG   Bacillus subtilis subsp. subtilis 168: BSU22170Help
Entry
BSU22170          CDS       T00010                                 

Gene name
ypsC
Definition
(RefSeq) RNA methyltransferase YpsC
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU22170 (ypsC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSU22170 (ypsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP MTS Cons_hypoth95 Methyltransf_31 Methyltransf_25 PrmA N6_N4_Mtase Eco57I Phage_clamp_A
Motif
Other DBs
NCBI-GeneID: 939057
NCBI-ProteinID: NP_390099
Pasteur: BG11455
BSORF: BG11455
UniProt: P50840
Position
complement(2330075..2331232)
Genome map
AA seq 385 aa AA seqDB search
MKKYTLIATAPMGIEAVVAKEVRDLGYECKVDNGKVIFEGDALAICRANLWLRTADRIKV
QVASFKAKTFDELFEKTKAINWRSFIPENGKFPVIGKSVKSTLASVPDCQRIVKKAIVEK
LKLQSGKANDWIEETGAEYKVEISLLKDQALITLDSSGTGLHKRGYRVDQGGAPIKETLA
AALVQLTNWTPDRPFVDPFCGSGTIAIEAALIGQNIAPGFNRDFVSEDWEWIGKDLWNKA
RLEVEEKANYDQPLTIFASDIDHRMVQIAKENAEEAGLGDLIQFKQMQVKDFTTNLEFGV
IVGNPPYGERLGEKKAVEQMYKEMGQAFEPLDTWSVYMLTSNENFEEAYGRKATKKRKLF
NGFIKTDYYQYWSKVRPQRKKTENA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtatacactaattgcaacggcgccgatgggcattgaagctgttgtcgcaaag
gaagtacgagatttaggatacgaatgcaaggttgataacgggaaagttatttttgaaggt
gatgcacttgccatctgccgtgcgaacctttggcttagaacagccgaccgcataaaggtt
caggttgcttcttttaaagcgaaaacatttgatgaactgtttgaaaaaacgaaagcgatt
aactggcgctcatttatacctgaaaacgggaaattccctgtcatcggaaaatcggtaaaa
tcaacacttgcaagcgttcctgactgtcagcggatcgtcaaaaaagcaattgtcgaaaag
ctcaagctgcagtccggcaaagccaatgattggattgaagaaacaggtgctgagtataaa
gtggaaatatctttattgaaagatcaggctttgattacactggactcatcagggacgggc
cttcacaaacgaggataccgtgtcgatcagggcggtgcgccgattaaagaaacacttgct
gccgctttggtgcaattaaccaattggacgcctgaccgcccgtttgttgatcctttctgc
ggctccggaacaatcgcgatagaagcggcgctaatcggccaaaacatcgccccgggattc
aaccgcgattttgtatcagaggattgggaatggatcggtaaagatctgtggaacaaagcg
cggcttgaagtcgaagaaaaggcaaattatgatcagccgcttacaattttcgctagcgac
atagaccaccgcatggttcaaatcgcaaaagaaaatgcagaggaagcaggattgggagat
ctaatccagttcaaacagatgcaggtcaaagactttaccacaaatctggaatttggcgta
attgtcggcaacccgccatatggagagcgtctcggcgagaaaaaagccgttgagcagatg
tacaaagaaatggggcaggcgttcgagccgcttgatacttggtctgtgtatatgctgaca
tcaaatgaaaactttgaggaagcatatggcagaaaagcaacgaagaaacgaaaactcttt
aacgggtttattaaaacggattattatcaatactggtcaaaagtaagaccgcagcgcaag
aaaacagaaaacgcataa

DBGET integrated database retrieval system