KEGG   Bacillus subtilis subsp. subtilis 168: BSU22180
Entry
BSU22180          CDS       T00010                                 

Gene name
ypsB
Definition
(RefSeq) cell cycle protein GpsB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DivIVA ZapB CCDC144C CCDC92 SHE3 DivIC Seryl_tRNA_N Herpes_BLRF2 UCH Spc24 DUF4446 ZYG-11_interact
Other DBs
NCBI-GeneID: 939054
NCBI-ProteinID: NP_390100
Pasteur: BG11454
BSORF: BG11454
UniProt: P0CI74 A0A6M4JN81
Structure
PDB: 
5AN5 6GPZ 6GP7 4UG3

Position
complement(2331779..2332075)
AA seq 98 aa
MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKK
QLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcttgctgataaagtaaagctttctgcgaaagaaattttggaaaaagaatttaaaaca
ggcgttagaggctacaagcaagaagacgttgacaaatttttagatatgattattaaggat
tatgaaaccttccatcaagaaattgaagaactgcagcaggaaaatctgcagctgaaaaaa
cagcttgaagaagccagcaaaaaacagcctgtgcaatctaacacaacaaactttgatatt
ttaaaacggctgtctaacttagaaaaacacgtttttggcagcaagctttatgattga

DBGET integrated database retrieval system