KEGG   Bacillus subtilis subsp. subtilis 168: BSU22180Help
Entry
BSU22180          CDS       T00010                                 

Gene name
ypsB
Definition
(RefSeq) cell cycle protein GpsB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA CCDC144C ZapB CCDC92 SHE3 DUF5638 DivIC Seryl_tRNA_N Herpes_BLRF2 Spc24 DUF4446 YabA ZYG-11_interact
Motif
Other DBs
NCBI-GeneID: 939054
NCBI-ProteinID: NP_390100
Pasteur: BG11454
BSORF: BG11454
UniProt: P0CI74
Structure
PDB: 

Position
complement(2331779..2332075)
Genome map
AA seq 98 aa AA seqDB search
MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKK
QLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgataaagtaaagctttctgcgaaagaaattttggaaaaagaatttaaaaca
ggcgttagaggctacaagcaagaagacgttgacaaatttttagatatgattattaaggat
tatgaaaccttccatcaagaaattgaagaactgcagcaggaaaatctgcagctgaaaaaa
cagcttgaagaagccagcaaaaaacagcctgtgcaatctaacacaacaaactttgatatt
ttaaaacggctgtctaacttagaaaaacacgtttttggcagcaagctttatgattga

DBGET integrated database retrieval system