KEGG   Bacillus subtilis subsp. subtilis 168: BSU22190Help
Entry
BSU22190          CDS       T00010                                 

Gene name
ypsA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YpsA
Motif
Other DBs
NCBI-GeneID: 939056
NCBI-ProteinID: NP_390101
Pasteur: BG11453
BSORF: BG11453
UniProt: P50838
Structure
PDB: 

Position
complement(2332153..2332782)
Genome map
AA seq 209 aa AA seqDB search
MENVQLDGVNNAAQQMGPTGAPFFKAGEMMKVLAITGYKPFELGIFKQDDKALYYIKKAI
KNRLIAFLDEGLEWILISGQLGVELWAAEAAYDLQEEYPDLKVAVITPFYEQEKNWKEPN
KEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGT
AEKRREQDGYPIYFITMDDLRVTVEEDSY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtgcagcttgatggtgtaaacaatgcagcacaacaaatggggcccacggga
gccccattttttaaagcaggtgaaatgatgaaagtattggcaataacgggctataaaccg
tttgaactggggatatttaagcaggatgacaaggcgctgtattacataaaaaaagccatt
aaaaaccggctgattgcttttttggatgaaggattagaatggattttaatttcgggccag
cttggagttgagctgtgggcggcagaagctgcatatgatttgcaggaggaataccctgac
ttaaaggtagctgtcatcacaccattttacgagcaggaaaagaactggaaagaaccgaat
aaagaacagtatgaagcagttctggctcaggcagactatgaagcaagcctgactcaccgt
ccttatgaaagcccgcttcaattcaaacaaaaaaatcagttcttcattgataagtccgac
gggcttctgcttttatatgacccggaaaaggaaggctcccctaagtatatgcttgggaca
gcggaaaaaaggcgcgaacaggatggctatcccatctactttattacaatggatgacttg
agagtgacagtggaggaagacagctactaa

DBGET integrated database retrieval system