KEGG   Bacillus subtilis subsp. subtilis 168: BSU22200Help
Entry
BSU22200          CDS       T00010                                 

Gene name
cotD
Definition
(RefSeq) spore coat protein D
  KO
K06327  spore coat protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU22200 (cotD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore-coat_CotD
Motif
Other DBs
NCBI-GeneID: 939051
NCBI-ProteinID: NP_390102
Pasteur: BG10493
BSORF: BG10493
UniProt: P07791
Position
complement(2332784..2333011)
Genome map
AA seq 75 aa AA seqDB search
MHHCRPHMMAPIVHPTHCCEHHTFSKTIVPHIHPQHTTNVNHQHFQHVHYFPHTFSNVDP
ATHQHFQAGKPCCDY
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcatcactgcagaccgcatatgatggcgccaattgtccatcctactcattgctgtgaa
caccatacgttttcgaagactatcgtgccgcacattcacccacagcatacaacaaacgta
aaccaccagcattttcagcacgttcactactttccacacactttctcaaatgttgacccg
gctacgcatcagcattttcaagcaggaaaaccttgctgcgactactag

DBGET integrated database retrieval system