KEGG   Bacillus subtilis subsp. subtilis 168: BSU22210
Entry
BSU22210          CDS       T00010                                 

Gene name
yprB
Definition
(RefSeq) hypothetical protein
  KO
K07502  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU22210 (yprB)
SSDB
Motif
Pfam: RNase_H_2 DNA_pol_B_exo1 TPR_14 TPR_6 TPR_19 DNA_pol_B_exo2 TPR_20 TPR_16 ANAPC3
Other DBs
NCBI-GeneID: 939050
NCBI-ProteinID: NP_390103
Pasteur: BG11452
BSORF: BG11452
UniProt: P50837 A0A6M4JL46
Position
complement(2333324..2334565)
AA seq 413 aa
MSLKGKLQRMKKHMALDEGEQKIEAGKQENHFDDIPFLEEWEAFGMKPFIFEDEYCLIRE
VEYPLSHRHGLYSFSELEEVITLWNQSGLSHTLSAKGYNKNNLFFFDTETTGLGGGAGNT
IFLLGHARVYEDRVTVKQHLLPKPGNEVALYQSFLSEVDITSLVTYNGKAFDWPQVKTRH
TLIRDRLPKLPEFGHFDLLHGARRLWKHKMDRVSLGTVEKEELGIRRLEDTPGYLAPMLY
FHFIKAQEPDLLKGVLHHNEMDVLSLISLYIHMSKKILSESHAPKEHSEAYAMAKWFMAH
KETDQAIKQLERLIEKSFEDQDSARLDLSLLYKKQNRLEEAVPLWEKLSRSQNQKCRYAA
VIELAKYFEHKKKEFGKALQVAEQSLSDAACLSEKETEKLHVRIARLKRKYSS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgtcattaaaagggaaactccaacggatgaaaaagcacatggcgctcgacgaaggagaa
caaaaaatagaagcaggcaaacaagaaaaccactttgatgacatcccgtttttagaagag
tgggaggcttttggcatgaagcctttcatcttcgaagatgaatattgcctcatcagagaa
gtagaatatccgctttctcaccgccatgggttatacagcttttctgagcttgaggaagtg
atcacactgtggaatcaaagcggcctgtcgcatacattgtcagcaaaagggtataacaaa
aacaacctctttttctttgatacagaaacaaccggtcttgggggtggagctgggaatacc
atttttttgcttgggcatgcgagagtatatgaagaccgagtgacagtcaaacagcatctt
ttgcccaaaccggggaacgaagtcgccttgtaccaaagctttttaagcgaggttgacatt
acatcacttgtgacctacaacggcaaagcctttgattggccgcaggtgaaaacaaggcac
accttgatccgtgacagacttccgaagcttccggagtttggccactttgatcttttgcat
ggagctagacgcctgtggaaacacaaaatggaccgtgtatctcttggcacggttgaaaaa
gaggagctcggcatccgcaggctagaagacacaccgggctacttggcgccaatgctttac
tttcattttatcaaggcgcaagagccggatcttttaaaaggtgtcctgcatcataatgaa
atggatgtgttatcactcatttcattgtacatccatatgtctaaaaaaatcctttcagaa
tcacatgcgccaaaagaacacagtgaagcctatgctatggcgaaatggtttatggctcat
aaagaaacggaccaagcgatcaagcagttggaaaggcttatagaaaaatcgtttgaggac
caggacagtgcacggctggatttatcgctcctgtacaaaaaacaaaaccgcttggaagaa
gcagtgccgctttgggaaaagctgtcccgctcgcaaaaccagaagtgcagatacgctgct
gtaatagagctcgcgaaatattttgagcataagaaaaaagaattcggaaaagcattgcaa
gtagcagagcaatcgcttagcgatgcggcatgcttatcagagaaagaaactgaaaaactg
catgtgagaattgcccggctaaagaggaaatattcctcttaa

DBGET integrated database retrieval system