KEGG   Bacillus subtilis subsp. subtilis 168: BSU22220Help
Entry
BSU22220          CDS       T00010                                 

Gene name
yprA
Definition
(RefSeq) ATP-dependent helicase YprA
  KO
K06877  DEAD/DEAH box helicase domain-containing protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU22220 (yprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD DUF1998 Helicase_C ResIII SUV3_C
Motif
Other DBs
NCBI-GeneID: 939052
NCBI-ProteinID: NP_390104
Pasteur: BG11451
BSORF: BG11451
UniProt: P50830
Position
complement(2334581..2336830)
Genome map
AA seq 749 aa AA seqDB search
MKKKSLTELISDLKGNENVVNWHEIEPREAKTRPMPESIDERIKAALSKRGIDELYTHQY
SAFQYVQKGESIVTVTPTASGKTLCYNLPVLQSIAQDETNRALYLFPTKALAQDQKSELN
EIIDEMGIDIKSFTYDGDTSPAIRQKVRKAGHIVITNPDMLHSAILPHHTKWVSLFENLK
YIVIDELHTYRGVFGSHVANVIRRLKRICRFYGSDPVFICTSATIANPKELGEQLTGKPM
RLVDDNGAPSGRKHFVFYNPPIVNKPLNIRRSATAEVNELAKEFLKNKVQTIVFARSRVR
VEIILSHIQELVKKEIGTKSIRGYRGGYLPKERREIERGLREGDILGVVSTNALELGVDI
GQLQVCVMTGYPGSVASAWQQAGRAGRRHGESLIIMVANSTPIDQYIVRHPEYFFNRSPE
SARINPENLIILVDHLKCAAYELPFRADEEFGAMEVSDILEYLQEEAVLHRNGERYHWAS
ESFPASNISLRSASQENVVIVDQSDIANVRIIGEMDRFSAMTLLHDEAIYLHEGVQYQVE
KLDWDHKKAYVRKVDVEYYTDANLAVQLKVLEIDKTKEKSRTSLHYGDVTVNALPTIFKK
IKMTTFENIGSGPIHLPEEELHTSAAWLEIKTADEDIGEKTLEQLLLGISNVLQHIVPVY
IMCDRNDVHVVSQIKAAHTGLPTIFLYDHYPGGIGLAEEVFKRFSDINEAAKQLITHCPC
HDGCPSCIGTEIEGIKAKERILQLLDQMS
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatcactgactgaactcatttctgatttaaaaggaaatgaaaacgttgtg
aattggcatgaaattgagcctcgggaagcaaaaacaaggcctatgcccgaaagtatagac
gagagaatcaaagcggccctttcgaaaaggggcattgatgaactatatactcaccaatat
tccgcttttcaatatgtgcaaaaaggagagagcatcgttaccgtaacgccaacagcatca
ggaaaaacgttatgctacaacctcccagtcctgcagtccatcgcccaagatgaaacaaac
cgggcgttatatttatttccgactaaagcgctggcacaagaccaaaagagcgagctaaat
gaaattattgatgaaatgggcattgatattaaaagctttacatatgacggggatacgtct
ccggcaatcagacaaaaggtgagaaaagcaggtcatattgtcattacaaaccccgatatg
ctgcattctgccattctaccgcatcatacgaaatgggtcagtttgtttgaaaaccttaag
tatatcgtcatcgatgagcttcatacgtatcgaggtgtgttcggcagccatgtggcaaat
gtgatccggcggctgaagcggatctgccggttttatggaagtgatccagtttttatttgt
acttccgcaacgattgccaacccaaaggaattgggagagcagctgacaggcaaaccgatg
cggctggtcgatgacaacggcgcaccgagcggacgcaagcattttgtgttttacaatccg
ccaattgtgaacaaaccgctgaatattagaaggagcgcaaccgcagaagtgaatgaactg
gcgaaagagttccttaaaaacaaagtgcagaccattgtttttgccagaagcagagttcgg
gtggaaattattttaagccatattcaggagcttgtgaaaaaagagattggaacaaaatca
atcagaggctatcggggaggctatctgccgaaagagcgaagagaaatcgaaagaggactg
agagaaggcgacattttaggagtggtcagtacgaatgccttagagcttggtgttgatatc
ggccagctgcaagtgtgtgtaatgacggggtatcccggaagtgttgcaagtgcttggcag
caggcgggacgagccggcagaagacacggtgaatctttgattatcatggtagccaattca
acaccgattgaccaatatattgtgcggcatcctgaatatttctttaatcgttcgccggaa
tctgcaagaatcaatccggagaatttgattattttagtagaccacttaaagtgtgcggct
tatgagcttccttttagagctgatgaagaatttggagccatggaagtcagtgatattctt
gagtatcttcaggaagaggctgttcttcaccgcaacggcgaacggtaccattgggcaagt
gagtcgttccctgcgtcaaacatcagtttgcgttccgcctcccaggaaaatgtcgttata
gttgatcagtcggatattgcaaatgtaaggattatcggtgaaatggaccgttttagtgcg
atgacgcttttgcatgatgaagcgatttatttgcatgaaggcgttcagtatcaagttgag
aagctcgattgggaccataaaaaggcgtatgtcagaaaagtcgatgtcgaatattatacg
gatgcaaacctggcagttcagctgaaggtattagaaatcgataaaacgaaagaaaaaagc
cgtacgtcattgcactacggagacgtcactgtcaatgccctgccgaccatttttaaaaaa
ataaaaatgaccacttttgaaaatattgggtctggacctattcatttgccggaagaagaa
ctgcatacaagtgcagcttggctcgaaatcaaaacagcggatgaagacatcggggaaaag
acactggaacagctgcttcttggcatctcgaatgtgctgcagcatattgtccctgtgtat
atcatgtgtgatcgaaatgatgttcatgttgtttctcaaattaaagcagcccataccgga
ttgccaaccatatttttatatgatcattatccgggcggtatcggtttggcggaggaagtc
tttaaacgtttttcagacattaatgaagcggcgaaacaactgattacacattgtccttgt
catgacggctgtccgtcttgtataggtacggaaatagaagggataaaagcaaaggaaaga
attttgcagctgttggatcaaatgtcgtaa

DBGET integrated database retrieval system