KEGG   Bacillus subtilis subsp. subtilis 168: BSU22230Help
Entry
BSU22230          CDS       T00010                                 

Gene name
ypqE
Definition
(RefSeq) PTS system transporter subunit IIA YpqE
  KO
K02777  PTS system, sugar-specific IIA component [EC:2.7.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu02060  Phosphotransferase system (PTS)
Module
bsu_M00268  PTS system, alpha-glucoside-specific II component
bsu_M00270  PTS system, trehalose-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU22230 (ypqE)
   00500 Starch and sucrose metabolism
    BSU22230 (ypqE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU22230 (ypqE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU22230 (ypqE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU22230 (ypqE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     BSU22230 (ypqE)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00265]
    BSU22230 (ypqE)
   Maltose/glucose-specific II component [MD:M00266]
    BSU22230 (ypqE)
   Maltose-specific II component [MD:M00806]
    BSU22230 (ypqE)
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component [MD:M00272]
    BSU22230 (ypqE)
   Trehalose-specific II component [MD:M00270]
    BSU22230 (ypqE)
   N-Acetylmuramic acid-specific II component [MD:M00303]
    BSU22230 (ypqE)
   Alpha-glucoside-specific II component [MD:M00268]
    BSU22230 (ypqE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 Peptidase_M23 Biotin_lipoyl PYNP_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 939046
NCBI-ProteinID: NP_390105
Pasteur: BG11450
BSORF: BG11450
UniProt: P50829
Position
complement(2336933..2337439)
Genome map
AA seq 168 aa AA seqDB search
MLKKLFGMGKIQEKVTEEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSP
AEGEVIQIFHTKHAVGIRTRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITC
DLELIKEKASSTVIPIVIMNGEAVGSMVSAGEKAARKGESKLFTIKAK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaaaaattattcggaatgggcaaaattcaggaaaaggtgacagaagaggttatt
tattctccggcagacggtacagtaatggacctgtcagatgtaccggaccctgttttttca
cagaaaatgatgggagaaggaatagcggtggaaccttctagcggtgaaatcgtttctccc
gctgaaggtgaagtcattcagattttccacaccaaacacgccgttggcattcggactcgc
tcgggaattgagctgttaattcatgtcgggctggagacagtcaatatgaacggagaagga
tttactgcccacattaaagaaggggataaagtgaaggtcggtgacccgctgattacatgt
gatttggaattaataaaagaaaaagcgagcagcacagtcatcccaatcgttataatgaat
ggtgaggctgtaggatcaatggtatcggcaggcgaaaaggctgctcgtaaaggcgaatca
aagctctttacaataaaagcgaaataa

DBGET integrated database retrieval system