KEGG   Bacillus subtilis subsp. subtilis 168: BSU22240Help
Entry
BSU22240          CDS       T00010                                 

Gene name
ypqA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NuA4 LicD PIH1_CS HSP20
Motif
Other DBs
NCBI-GeneID: 939048
NCBI-ProteinID: NP_390106
Pasteur: BG11449
BSORF: BG11449
UniProt: P50836
Position
2337577..2337996
Genome map
AA seq 139 aa AA seqDB search
MEFHDDKKNELQKKEEIITEAIDTLFQSSAFGNLINGFQNLINSSLKDVQTTIHVRERDT
GLYIDITIPATFRDGEIVVDVKSRYLHVTLQEKQKHQNEATFTSMTRTVQLPYEVRQEDM
ETSWNEQTMTLFFPKNKHE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
ttggaattccatgatgacaaaaagaacgaactgcaaaagaaagaagaaatcataacggag
gcaatcgacactctttttcaatcctcagcgttcggcaaccttataaacggatttcagaac
ctaatcaactcgagtttaaaggatgtgcagacgaccatacatgtcagagaaagagatact
gggctgtatatcgatattaccattccggcgacgtttcgagatggcgagatcgtcgttgat
gttaaatcgaggtatctccatgtaacactccaagaaaaacagaaacaccaaaatgaggct
acctttacaagcatgacaagaacggttcagctgccttatgaagttcgccaagaagatatg
gaaacgtcttggaacgagcagacaatgacacttttctttccaaaaaataagcatgaatga

DBGET integrated database retrieval system