KEGG   Bacillus subtilis subsp. subtilis 168: BSU22250Help
Entry
BSU22250          CDS       T00010                                 

Gene name
yppG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppG YlbD_coat
Motif
Other DBs
NCBI-GeneID: 939049
NCBI-ProteinID: NP_390107
Pasteur: BG11448
BSORF: BG11448
UniProt: P50835
Position
complement(2338017..2338394)
Genome map
AA seq 125 aa AA seqDB search
MNGSSRSYPRQMGYYYPQHMQGYYQQAAPGYLEQQLPQQHYGQQDYYQPYAPIQPMPMQP
PVFSNPYPIPRPNQQQPSQFQSIMSQFKKANGQFDFNKMMDTTGQVMSAMNQVGSLIKGF
TSFFK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggagctctcgaagctatcctcggcaaatgggctattattatcctcagcatatg
caaggatattatcagcaggctgcacccggttatttagagcaacaactgcctcagcagcat
tatggacagcaggattattatcagccttatgctccgatccagcctatgcctatgcagccg
cctgtattttctaacccttatcctatcccaaggcctaatcaacagcagccttcacaattt
caaagcattatgtcgcagttcaaaaaagccaatgggcaatttgattttaataaaatgatg
gatacgacaggtcaagtaatgagtgcaatgaatcaggtcggatctttaataaagggattt
accagcttttttaaatga

DBGET integrated database retrieval system