KEGG   Bacillus subtilis subsp. subtilis 168: BSU22260Help
Entry
BSU22260          CDS       T00010                                 

Gene name
yppF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppF DNA_pol_B_exo2 CHORD
Motif
Other DBs
NCBI-GeneID: 939045
NCBI-ProteinID: NP_390108
Pasteur: BG11447
BSORF: BG11447
UniProt: P50834
Position
2338582..2338770
Genome map
AA seq 62 aa AA seqDB search
MNVSYLSKRFAEMKKYETDCMNKLMDFAKFLYIQGHLSITEFRNSMKVLEANGAESPAYE
MN
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatcatacttaagcaaacgttttgcagaaatgaagaaatatgaaacagactgt
atgaataaactgatggactttgccaagttcctctatattcaaggacatctcagcataact
gagtttcgtaacagtatgaaggttctcgaagcaaatggagcagaaagcccggcatatgag
atgaattaa

DBGET integrated database retrieval system