KEGG   Bacillus subtilis subsp. subtilis 168: BSU22260
Entry
BSU22260          CDS       T00010                                 

Gene name
yppF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YppF CHORD DNA_pol_B_exo2
Other DBs
NCBI-GeneID: 939045
NCBI-ProteinID: NP_390108
Pasteur: BG11447
BSORF: BG11447
UniProt: P50834 A0A6M4JNJ4
Position
2338582..2338770
AA seq 62 aa
MNVSYLSKRFAEMKKYETDCMNKLMDFAKFLYIQGHLSITEFRNSMKVLEANGAESPAYE
MN
NT seq 189 nt   +upstreamnt  +downstreamnt
atgaacgtatcatacttaagcaaacgttttgcagaaatgaagaaatatgaaacagactgt
atgaataaactgatggactttgccaagttcctctatattcaaggacatctcagcataact
gagtttcgtaacagtatgaaggttctcgaagcaaatggagcagaaagcccggcatatgag
atgaattaa

DBGET integrated database retrieval system