KEGG   Bacillus subtilis subsp. subtilis 168: BSU22270
Entry
BSU22270          CDS       T00010                                 

Gene name
yppE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1798 DUF459
Other DBs
NCBI-GeneID: 939047
NCBI-ProteinID: NP_390109
Pasteur: BG11446
BSORF: BG11446
UniProt: P50833 A0A6M4JN83
Structure
PDB: 
2IM8 2HFI

Position
complement(2338809..2339180)
AA seq 123 aa
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALE
LIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIARE
DSR
NT seq 372 nt   +upstreamnt  +downstreamnt
ttgctatcacaaactttgctggaaatgaccgagcaaatgattgaagttgctgaaaaaggc
gctgatcggtatcaggaaggaaaaaacagtaatcattcttatgatttttttgagacgata
aagcctgcagttgaagagaatgatgaactggctgctcgctgggcagagggtgctcttgaa
ttgataaaagtccgccggccaaaatatgtgcataaagagcaaattgaggccgtaaaggat
aatttcctggaattggtccttcaatcttatgttcatcatattcataaaaaacgattcaag
gacatcactgagtcagtcctttatacattgcacgcagtaaaggatgaaattgcaagagaa
gacagccggtaa

DBGET integrated database retrieval system