KEGG   Bacillus subtilis subsp. subtilis 168: BSU22300Help
Entry
BSU22300          CDS       T00010                                 

Gene name
yppC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2515
Motif
Other DBs
NCBI-GeneID: 939043
NCBI-ProteinID: NP_390111
Pasteur: BG10952
BSORF: BG10952
UniProt: P39791
Position
complement(2339799..2340761)
Genome map
AA seq 320 aa AA seqDB search
MNVQEQQAIRKLLSRIERQTKMKNADNISRTNAYKAFYDRHPEIKWSLLASFVSRNAGWS
MTDLKGSLFQLGLRERQQKWFFLAYERANWLIFSDAYPQLLLYHWSKRVGKPLFHLLHVF
GVSQFMSEEWTRFWHERNTERLMYALIINEQNTIQTPIIQNPSFKKNVFDTIPFYLSDWF
HFNTVIFPSSNGFFYGISVKRFSKAEERIRLGKQLSQLLFKPELFSSFYHFLHTVPHTGS
RFDMEKMIGITKRTSPMLRTCYPELIHSLDGTKTDWFHGKIKKTFFRREELPKQIELTDW
YLHKKRQLHALFAVEQWLKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcaagaacaacaggccatcagaaagcttctgagccggattgagcggcagaca
aaaatgaaaaacgcggataacatttcaagaacaaatgcttataaagcattttacgaccgt
catccggaaatcaaatggtcgcttttggcttctttcgtttctcgtaatgccggctggtca
atgactgacttaaaaggcagtctgtttcagcttggactccgtgagagacagcaaaaatgg
ttctttttagcctatgaaagagcgaactggcttattttttcggatgcctatccgcagctt
cttttataccactggtcaaaaagagttgggaaaccgctgtttcatctgctgcatgtgttt
ggcgtctcacaatttatgtcggaagaatggacccgtttttggcatgagcgaaatacggag
cggctaatgtatgccctcattataaatgaacaaaacactatccaaacacctattatacaa
aatccttcgtttaaaaagaatgtttttgacacgattcctttttatttaagtgactggttt
cattttaacaccgttatttttccttcctcaaatgggtttttttacggcatttcagtgaaa
cgcttttcaaaggcggaggaaaggataaggctgggaaagcagctgtctcaattgctgttc
aagccagaattgttctcctctttttatcactttttgcacacagtgccgcacacaggttcc
cgttttgatatggaaaagatgatcgggattacaaaaagaacatctcctatgctaaggaca
tgctaccctgagttaatccactcattagacggaacgaaaacagattggtttcatggaaag
ataaagaaaacgttctttaggcgcgaggaattgccgaagcagattgaattgacagactgg
tatttacataaaaagcgccagcttcatgcgctttttgcggtggagcagtggctgaaaaaa
taa

DBGET integrated database retrieval system