KEGG   Bacillus subtilis subsp. subtilis 168: BSU22310
Entry
BSU22310          CDS       T00010                                 

Gene name
recU
Definition
(RefSeq) holliday junction resolvase RecU
  KO
K03700  recombination protein U
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU22310 (recU)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU22310 (recU)
SSDB
Motif
Pfam: RecU
Other DBs
NCBI-GeneID: 939039
NCBI-ProteinID: NP_390112
Pasteur: BG10953
BSORF: BG10953
UniProt: P39792 A0A6M4JL55
Structure
PDB: 
1ZP7 1RZN 5FDK

Position
2340802..2341422
AA seq 206 aa
MIRYPNGKTFQPKHSVSSQNSQKRAPSYSNRGMTLEDDLNETNKYYLTNQIAVIHKKPTP
VQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQ
IEHMKQVKAQDGICFVIISAFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPIS
LGYAPRIDYISIIEQLYFSPSSGAKG
NT seq 621 nt   +upstreamnt  +downstreamnt
gtgattcggtatcctaatggaaaaacatttcagccgaaacattcggtttcatcccaaaac
agtcagaaaagggccccgtcttacagtaatcgcggaatgaccctcgaagatgacttaaac
gaaacgaataagtattatctgacaaaccaaattgccgttatacacaaaaagccgacacct
gttcaaattgtaaatgtccattatccaaaaagaagtgccgcagtgattaaagaagcttac
tttaaacaatcatcgacaacagactacaatgggatttacaaagggcggtatattgatttt
gaggcgaaagaaacgaaaaacaagacctctttccccctgcagaattttcatgaccatcaa
atcgagcatatgaagcaggtaaaggctcaagacggtatttgttttgttattatatccgct
ttcgaccaggtttattttttggaagccgataagctgttttatttctgggacagaaaagaa
aaaaacggcagaaaatcaattcgaaaagatgagttggaagaaacagcttatccgatttct
cttggatacgcacccagaattgattatattagtattattgaacagctttatttttcgcca
tcatctggtgcgaaaggttga

DBGET integrated database retrieval system