KEGG   Bacillus subtilis subsp. subtilis 168: BSU22330
Entry
BSU22330          CDS       T00010                                 

Gene name
ypoC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939041
NCBI-ProteinID: NP_390114
Pasteur: BG10955
BSORF: BG10955
UniProt: P39789 A0A6M4JK46
Position
complement(2344264..2344758)
AA seq 164 aa
MTQAKEVLASYEQYLRSLGQKSSSDMKKTLQTNPVYFDFCTELQGDLPWEDSGKYVPLLF
EVWDDIKASLLPVFQTRKSRCDQNEMLKGIVCLLASLHWTAGEPVKSLDWQELREKSYPA
KPINWAERVEFILLKPTQYHCFIQLDELITEMKKHFYKYHAMNR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacgcaagcaaaagaagtgttggcttcctatgagcaatacttgcgcagtcttggccag
aagagttcctcggatatgaagaaaaccttgcagaccaatcccgtgtattttgatttctgc
acggaattacaaggcgatttgccatgggaggacagcgggaaatacgttccgcttttattt
gaagtgtgggatgacatcaaagcatcacttctcccagtctttcaaacacgaaaatcgaga
tgtgaccaaaacgaaatgttaaagggcattgtgtgtttgctggcttcgttacattggaca
gcaggtgagccggtgaaatcgctcgattggcaagaactgagggagaaatcatatcccgca
aagccgattaattgggctgaacgagtggaatttattcttcttaagccgacccaataccat
tgctttattcagcttgatgagctgattaccgaaatgaaaaagcatttttataaatatcat
gcgatgaatcgataa

DBGET integrated database retrieval system