KEGG   Bacillus subtilis subsp. subtilis 168: BSU22350
Entry
BSU22350          CDS       T00010                                 

Gene name
dnaD
Definition
(RefSeq) DNA replication protein DnaD
  KO
K02086  DNA replication protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU22350 (dnaD)
SSDB
Motif
Pfam: DnaB_2 Fungal_KA1 FYRC
Other DBs
NCBI-GeneID: 939040
NCBI-ProteinID: NP_390116
Pasteur: BG10957
BSORF: BG10957
UniProt: P39787 A3F2Y0
Structure
PDB: 
2V79

Position
complement(2345433..2346131)
AA seq 232 aa
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEG
MSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQNQTQER
KAEGEQKSLYTIFEEEFARPLSPLECETLAIWQDQDQHDAQLIKHALKEAVLSGKLSFRY
IDRILFEWKKNGLKTVEQAKIHSQKFRRVQAKQNEPQKEYKRQVPFYNWLEQ
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaaaaacagcaatttattgatatgcaggagcagggaacatcaaccatccccaatctt
ctgctcacgcattataaacagcttgggcttaatgaaacagaacttattctgctgttaaaa
attaaaatgcatttagaaaaaggatcatattttcctacaccgaatcagctgcaggaaggt
atgtcaatttctgttgaagaatgtacaaacagattgcggatgtttattcaaaaaggcttt
ctgtttattgaagaatgcgaggatcaaaacggcatcaaatttgagaaatattctcttcag
cctttatggggcaagctgtacgagtatattcagcttgcacagaatcaaacacaggaaaga
aaagcagaaggggaacaaaaaagcctttataccatttttgaggaagagttcgcaagaccg
ttatcgcctttggagtgtgaaacgctggcgatctggcaggaccaggatcagcatgacgca
caactgatcaaacacgcgttaaaagaggctgtactatcaggaaaactcagtttccgctac
attgaccggattttgtttgaatggaagaaaaatgggcttaaaactgtggagcaggcaaaa
atacacagccaaaaattccggcgtgtacaagcaaagcagaatgaaccgcaaaaagagtat
aaaaggcaggttcctttttacaattggcttgaacaataa

DBGET integrated database retrieval system