KEGG   Bacillus subtilis subsp. subtilis 168: BSU22360
Entry
BSU22360          CDS       T00010                                 

Gene name
asnC
Definition
(RefSeq) asparagine--tRNA ligase
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU22360 (asnC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU22360 (asnC)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU22360 (asnC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     BSU22360 (asnC)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BSU22360 (asnC)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU22360 (asnC)
 Prokaryotic type
    BSU22360 (asnC)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Other DBs
NCBI-GeneID: 939038
NCBI-ProteinID: NP_390117
Pasteur: BG10958
BSORF: BG10958
UniProt: P39772 A0A6M3ZM76
Position
complement(2346224..2347516)
AA seq 430 aa
MKTTINQVYKHVGEEVTIGAWVANKRSSGKIAFLQLRDGTGFIQGVVVKAEVEESIFQTA
KSVTQETSLYIKGIVKEDERSPLGYELAVTDIEVIHEATDYPITPKEHGTEFLMDHRHLW
LRSKRQHAIMKIRNEIIRATYEFFNNEGFVKVDPPILTGSAPEGTTELFATKYFDEDAYL
SQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTKRHLIEFWMIEPEMAFVEFEENLQVQEN
YVSFIVQSVLKNCKIELNTLGRDTSKLEQIKAPFPRITYDEAIEFLKEKGFDDIEWGDDF
GAPHETAIAEHYDKPVFITRYPTSLKPFYMQPASDREDVVLCADLIAPEGYGEIIGGSER
IHDMELLESRLKEHGLDSDAYKWYAELRKYGSVPHSGFGLGLERTVAWISGAPHVRETIP
FPRLLNRLYP
NT seq 1293 nt   +upstreamnt  +downstreamnt
ttgaaaacaacaatcaaccaagtgtacaagcacgtaggtgaggaagtaacgatcggagct
tgggtcgctaataagcgttcaagcgggaaaattgcgtttttacagcttcgggacggtacc
ggttttattcagggtgtcgtagtaaaagcggaagtggaagaaagcattttccaaacagct
aaatcagtgacgcaggaaacgtcgctctatataaaagggattgtcaaagaggacgagcgt
tctccgcttggatatgaacttgctgtgacagatattgaagtcattcacgaagcgaccgat
tatccaattacaccaaaagaacacggaacggaatttttgatggatcacagacatttatgg
ctgcgttcaaagcgccagcatgcgatcatgaaaatccgtaatgaaatcattcgcgcgact
tacgaattctttaataacgaaggcttcgtaaaagtggatccgccgattttgactggaagc
gcacctgaaggaacaacagaactctttgcgacaaagtactttgatgaagatgcatatctg
tctcaaagcggacagctctacatggaagctgcggcaatggctttaggaaaagtattctct
ttcggaccgacattcagagcggaaaagtctaaaacaaagcgtcacttaatcgaattctgg
atgatcgaaccggaaatggcgtttgtagaatttgaagaaaaccttcaagtacaggaaaat
tacgtttctttcatcgtgcaatcagttcttaaaaattgcaaaattgaactaaacacattg
ggaagagacacgtcaaaacttgagcaaatcaaagccccgttcccaagaattacgtatgat
gaagcgattgaatttctgaaagaaaaaggctttgacgatatcgagtggggagatgatttc
ggagcgcctcatgaaacagcgattgctgaacattatgacaaaccggtattcatcactcgc
tatccgacgtccttaaaaccgttctatatgcagccggcttctgaccgtgaggacgttgtg
ctttgcgctgacttgattgcgccggaaggctatggagaaatcatcggcgggtctgaacgg
attcacgatatggaacttttggaatcgcgtcttaaagaacatggactggattctgacgct
tataaatggtatgctgaacttagaaaatatggatcagttcctcattccggcttcggcctt
ggattagagcggacagtagcttggatcagcggagcgcctcacgttcgtgaaacgattccg
ttcccaagactgttaaaccgtctgtatccgtaa

DBGET integrated database retrieval system