KEGG   Bacillus subtilis subsp. subtilis 168: BSU22370
Entry
BSU22370          CDS       T00010                                 

Gene name
aspB
Definition
(RefSeq) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00270  Cysteine and methionine metabolism
bsu00330  Arginine and proline metabolism
bsu00350  Tyrosine metabolism
bsu00360  Phenylalanine metabolism
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu00401  Novobiocin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU22370 (aspB)
   00270 Cysteine and methionine metabolism
    BSU22370 (aspB)
   00220 Arginine biosynthesis
    BSU22370 (aspB)
   00330 Arginine and proline metabolism
    BSU22370 (aspB)
   00350 Tyrosine metabolism
    BSU22370 (aspB)
   00360 Phenylalanine metabolism
    BSU22370 (aspB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU22370 (aspB)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BSU22370 (aspB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU22370 (aspB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BSU22370 (aspB)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class I
   BSU22370 (aspB)
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 Lipoprotein_22 PfkB OKR_DC_1
Other DBs
NCBI-GeneID: 939037
NCBI-ProteinID: NP_390118
Pasteur: BG11513
BSORF: BG11513
UniProt: P53001 A0A6M3ZD26
Position
complement(2347660..2348841)
AA seq 393 aa
MKLAKRVSALTPSTTLAITAKAKELKAAGHDVIGLGAGEPDFNTPQHIIDAAVRSMNEGH
TKYTPSGGLAELKNSIAEKFKRDQNIEYKPSQIIVCTGAKHALYTLFQVILDEEDEVIIP
TPYWVSYPEQVKLAGGKPVYVEGLEENHFKISPEQLKNAITEKTKAIVINSPSNPTGVMY
TEEELSALGEVCLEHDILIVSDEIYEKLTYGGKKHVSIAQLSDRLKEQTVIINGVSKSHS
MTGWRIGYAAGSEDIIKAMTNLASHSTSNPTSIAQYGAIAAYNGPSEPLEEMREAFEHRL
NTIYAKLIEIPGFSCVKPEGAFYLFPNAKEAAQSCGFKDVDEFVKALLEEEKVAIVPGSG
FGSPENVRLSYATSLDLLEEAIERIKRFVEKHS
NT seq 1182 nt   +upstreamnt  +downstreamnt
ttgaaactggcaaaaagagtatccgcattaacaccatcaaccacactggcaatcacagcg
aaagcgaaagaactgaaagccgcaggccatgatgtcatcggcttaggagcaggcgagcct
gacttcaatacaccgcagcatattattgatgccgctgtgcgttcgatgaacgagggccat
acgaaatacacgccttccggtggtttggctgaactgaaaaacagcattgcagagaaattt
aaacgcgaccagaatattgaatacaaaccgtctcaaattattgtctgcactggtgccaaa
catgctctgtatacccttttccaagtgattttggatgaagaagatgaagttattattcca
acgccttactgggtaagctacccggagcaggtgaaactcgctggcggaaagcctgtttat
gtagaagggcttgaggaaaatcacttcaaaatttcgcctgagcagctgaaaaatgcaatt
acggaaaaaacaaaagcaatcgttattaactctccaagcaacccgactggtgtcatgtat
acggaagaagaactatctgcgctcggtgaagtgtgccttgaacatgatatcttgattgtg
tcagatgaaatttatgaaaaacttacatacggcggaaagaaacatgtttccattgcacag
ctgtcagacagactgaaagagcaaacggtcattataaacggcgtatcgaagtcccacagc
atgacaggctggagaatcggttatgcggcaggctctgaagacattattaaagcgatgacg
aaccttgcaagccacagcacgtcaaacccgacatcaatcgcacaatacggagcgattgct
gcttataacgggccttctgagccattggaagaaatgagagaagcatttgaacatagatta
aatacgatctatgcaaagctcatagaaatcccagggttcagctgcgtgaagccggaaggt
gctttttacttgttcccaaatgcaaaagaggcagctcaatcttgcggtttcaaagatgta
gatgaatttgttaaagcgcttctcgaggaggaaaaagttgcgattgttccaggatccgga
tttggctctcctgagaatgtccgtctttcttatgcaacatcgttagatcttcttgaagaa
gccattgaaagaatcaagcgttttgtagaaaaacatagctaa

DBGET integrated database retrieval system