KEGG   Bacillus subtilis subsp. subtilis 168: BSU22380
Entry
BSU22380          CDS       T00010                                 

Gene name
ypmB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5590 PepSY Cytidylate_kin2 DUF2500 GRP
Other DBs
NCBI-GeneID: 939035
NCBI-ProteinID: NP_390119
Pasteur: BG11502
BSORF: BG11502
UniProt: P54396 A0A6M4JIK4
Structure
PDB: 
2GU3

Position
complement(2348864..2349349)
AA seq 161 aa
MRKKALIFTVIFGIIFLAVLLVSASIYKSAMAQKEEGHEAAAAEAKKETDLAHVDQVETF
VGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDKAAKIIKDEGLVSKQKE
VHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagaaaaaaagcattaatatttaccgtcatttttggtattatttttttagcagtactt
cttgtctcggcaagcatttataaatcagccatggcacaaaaggaagaggggcacgaagca
gcagctgctgaagctaaaaaagaaaccgatctcgcccatgttgatcaagtcgaaacattt
gtcggaaaagaaaaatattatgttgtaaagggaacggataaaaaaggcactgcattatat
gtctgggttcctgctgataaaaaagcaaaaattctctcaaaagaagcgaaagagggaatc
tctgaagacaaagcggcgaaaatcataaaggatgaagggctggtttcaaagcaaaaagag
gttcatctggcaagagaaggaaacgtcctgctttgggaagtgacgtacttagacaaagaa
gggcaatacagtttaagttatgtggactttacaactggaaagattctcaaaaatatcacg
ccttaa

DBGET integrated database retrieval system