KEGG   Bacillus subtilis subsp. subtilis 168: BSU22390
Entry
BSU22390          CDS       T00010                                 

Gene name
ypmA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4264
Other DBs
NCBI-GeneID: 939034
NCBI-ProteinID: NP_390120
Pasteur: BG11501
BSORF: BG11501
UniProt: P54395 A0A6M4JIG8
Position
complement(2349358..2349528)
AA seq 56 aa
MESKIEILSTINVEHSDDLYKIVDTLNRTLKRDNLMFGLALDEENKNQAVFTIYRT
NT seq 171 nt   +upstreamnt  +downstreamnt
atggaaagtaaaatcgaaattctttcaacaattaatgtagagcattctgatgatctgtat
aaaattgtggacacattgaatcgtacactgaaaagagacaatctgatgttcggccttgcg
ctggatgaagaaaacaaaaaccaagccgtttttaccatttatcgtacgtag

DBGET integrated database retrieval system