KEGG   Bacillus subtilis subsp. subtilis 168: BSU22400
Entry
BSU22400          CDS       T00010                                 

Symbol
dinG
Name
(RefSeq) ATP-dependent helicase DinG
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU22400 (dinG)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     BSU22400 (dinG)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    BSU22400 (dinG)
SSDB
Motif
Pfam: RNase_T Helicase_C_2 DEAD ResIII Helicase_C T4SS-DNA_transf
Other DBs
NCBI-GeneID: 939031
NCBI-ProteinID: NP_390121
Pasteur: BG11515
BSORF: BG11515
UniProt: P54394 A0A6M3ZGN4
Position
complement(2349671..2352466)
AA seq 931 aa
MNKQRFVVIDVETTGNSPKKGDKIIQIAAVVIENGQITERFSKYINPNKSIPAFIEQLTG
ISNQMVENEQPFEAVAEEVFQLLDGAYFVAHNIHFDLGFVKYELHKAGFQLPDCEVLDTV
ELSRIVFPGFEGYKLTELSEELQLRHDQPHRADSDAEVTGLIFLEILEKLRQLPYPTLKQ
LRRLSQHFISDLTHLLDMFINENRHTEIPGYTRFSSFSVREPEAIDVRINEDENFSFEIE
SWEAGNEKALSELMPGYEKRDGQMMMMREVADAFANREHALIEAPPGIGKTIGYLIPAAL
FAKKSKKPVIISTYSTLLQQQILTKDLPIVQDLFPFPVTAAILKGQSHYLCLYKFEQVLH
EEDDNYDAVLTKAQLLVWLTETNTGDVAELNLPSGGKLLWDRLAYDDDSYKRSRSEHVIG
FYERAKQIAMRSDLVITNHSLLLTDEGSHKKRLPESGTFIIDEAHHFERAASEHLGKRAT
YIELHTKLSRIGTLKEQGLLKKMRQLFQRNSLPVDSFFELEEWLQHVQAESDAFFSSVHS
FVKRRKPKEDLNRLVFKVNKESQDKSWSILTDGAERLCSMLTHLQQLFEAQSSLMEKHLK
GMKSKTVFLADEYQRSMKGLQHYCQTLQKLFFGSDDDEAVWIEIDAKGAKNAVAIYAQPL
EPGELLADQFFARKNSVVLTSATLTVEGSFQFMIERLGLSDFFPRTMRIESPFSYDERMQ
VMIPKEMKSIQDTGQPEFIQDTARYIELMAKEKQPKILVLFTSHDMLKKVHQELKHNMSA
SGIQLLAQGITGGSPGKLMKTFKTSNQAILLGTNHFWEGVDFPGDELTTVMIVRLPFRSP
DHPLHAAKCELARKKGKNPFQTVSLPEAVLTFRQGIGRLLRSAGDKGTIIILDRRIKTAG
YGRLFLDALPTTSVSEMTDSELEAYVAGEKE
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgaataagcaacggttcgttgttatagatgtagagacaacagggaattcgccgaagaaa
ggcgataaaatcatacaaatcgcagcggttgtaatcgaaaatggacaaattactgagcgg
ttttcaaaatacattaatccaaataaatcaatccctgcttttattgagcagcttactgga
atctctaatcaaatggtcgagaatgaacagccatttgaagcagttgctgaagaagtattc
caattgcttgacggcgcttattttgtcgcccacaatatccattttgaccttggatttgtc
aagtatgagctacataaggcgggctttcagctcccagattgtgaagtgcttgatactgtc
gagctctcacgcattgtttttccgggatttgaagggtataagctgacggaattaagcgag
gagcttcagctgcggcatgatcagccgcaccgggctgacagcgatgctgaagtgacaggg
cttatttttttggaaatccttgaaaagctgcggcagcttccttatccgacattaaagcag
ttaagaaggctttcgcagcatttcatcagtgatctgacgcatttgttggatatgttcatt
aatgaaaacagacataccgagataccgggctatacgcgcttttcttcgttttctgtcaga
gaacctgaagctatcgatgttcgtataaatgaggacgagaacttctcatttgagatcgaa
agctgggaagcgggaaatgaaaaagcgctgtcagagttaatgcctgggtatgaaaaaaga
gacggccaaatgatgatgatgagagaggtggctgatgcgtttgccaatcgtgagcatgcg
ctgattgaagctcctccaggcatcggaaaaacgattggctatcttattccggctgcgctt
tttgccaagaaatcaaaaaagccggtcataatcagcacgtattcgacgcttttacagcag
cagattctcacaaaggatttgccgattgtccaagatctgtttccatttccggtaacagcg
gcgattttaaaagggcaatcgcattatttatgcctgtataaatttgagcaggtgcttcat
gaagaagatgataattatgatgccgtactgacaaaggcacagcttcttgtttggctgaca
gagacaaatacaggagatgtagcggaactgaatttgccttcaggcggaaaattgctgtgg
gacagattggcttatgacgatgactcctataaaagaagtcgcagtgagcatgtgatcggt
ttttacgagcgggccaaacagattgctatgcgttccgatttggtgatcaccaatcattct
cttttgctgaccgatgaaggcagccataaaaaaaggcttcccgaaagcggcacatttatt
attgatgaagcacaccattttgaacgtgcggcaagcgaacatttagggaaaagagccacg
tacatagaattgcatacgaaattgagcagaatcggcactctgaaggagcagggacttcta
aaaaagatgagacagctattccagcgaaacagcctgccggttgattcatttttcgaattg
gaagagtggcttcagcacgttcaagcagaaagtgatgctttctttagctctgtacattct
tttgtcaaacgaagaaaacctaaagaagacttaaaccgtctagtgtttaaggtgaacaaa
gaaagccaggataaaagctggtcgatcttaacagatggtgcggagaggctttgttccatg
ctgacacatttgcagcagctttttgaggcgcagtcatcccttatggaaaaacatttgaag
ggcatgaagagcaaaaccgtctttttagccgatgaataccaaagaagcatgaaaggcttg
cagcattactgtcagacgttgcagaagctcttctttggctctgatgacgatgaagcggtt
tggattgaaatagatgcaaagggtgcgaaaaatgcagtggccatttacgcacagcctctt
gaacctggtgaacttctggctgatcagtttttcgcgcgcaaaaatagtgtggtgctgaca
tctgcaactcttacagtcgaaggttcttttcaatttatgattgaacgactgggactgagt
gactttttcccgcggacaatgagaattgagtcacccttttcttacgatgagcgtatgcag
gtgatgattccaaaagaaatgaaatcaattcaggatacagggcaacctgaatttatacag
gatacagcccgttatatcgaactgatggcaaaggaaaaacagcctaaaatccttgtgctg
tttacatcccatgatatgctgaaaaaggttcaccaggagcttaagcataacatgagtgct
tccggcattcagctcttggcacaagggattacaggcggaagtcccggcaaactgatgaag
acttttaaaacatccaatcaggcgatcctgctcggaacaaatcatttttgggaaggcgtt
gatttccctggtgatgagctgacgacagtaatgatcgtgaggctcccattccggtcccct
gatcacccgcttcatgctgcaaaatgtgagcttgcccgcaaaaaaggaaagaatccgttt
caaacagtgtcattaccggaagctgtgctgaccttcaggcaaggaatcggacgcttgctg
cgttctgcgggagacaagggaacgattattatattggacagacggattaaaaccgctggt
tacggccggctgtttcttgatgccttgccgacaacctcagtatccgaaatgactgacagc
gagcttgaagcttatgttgcaggggaaaaagaataa

DBGET integrated database retrieval system