KEGG   Bacillus subtilis subsp. subtilis 168: BSU22410
Entry
BSU22410          CDS       T00010                                 

Gene name
panD
Definition
(RefSeq) aspartate 1-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00410  beta-Alanine metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU22410 (panD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU22410 (panD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     BSU22410 (panD)
SSDB
Motif
Pfam: Asp_decarbox DUF4467
Other DBs
NCBI-GeneID: 939033
NCBI-ProteinID: NP_390122
Pasteur: BG11493
BSORF: BG11493
UniProt: P52999 A0A6M4JKA2
Position
complement(2352592..2352975)
AA seq 127 aa
MYRTMMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQIVNNNNGARLETYII
PGKRGSGVICLNGAAARLVQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIEQMLGN
EPARTIL
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtatcgaacaatgatgagcggcaaacttcacagggcaactgttacggaagcaaacctg
aactatgtgggaagcattacaattgatgaagatctcattgatgctgtgggaatgcttcct
aatgaaaaagtacaaattgtgaataataataatggagcacgtcttgaaacgtatattatt
cctggtaaacggggaagcggcgtcatatgcttaaacggtgcagccgcacgccttgtgcag
gaaggagataaggtcattattatttcctacaaaatgatgtctgatcaagaagcggcaagc
catgagccgaaagtggctgttctgaatgatcaaaacaaaattgaacaaatgctggggaac
gaaccagcccgtacaattttgtag

DBGET integrated database retrieval system