KEGG   Bacillus subtilis subsp. subtilis 168: BSU22420
Entry
BSU22420          CDS       T00010                                 

Symbol
panC
Name
(RefSeq) pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00410  beta-Alanine metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU22420 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU22420 (panC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     BSU22420 (panC)
SSDB
Motif
Pfam: Pantoate_ligase
Other DBs
NCBI-GeneID: 939030
NCBI-ProteinID: NP_390123
Pasteur: BG11520
BSORF: BG11520
UniProt: P52998 A0A6M3ZIK8
Position
complement(2352977..2353837)
AA seq 286 aa
MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPA
QFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRS
REGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREED
GLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDY
VELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagacagattactgatatttcacagctgaaagaagccataaaacaataccattcagag
ggcaagtcaatcggatttgttccgacgatggggtttctgcatgaggggcatttaacctta
gcagacaaagcaagacaagaaaacgacgccgttattatgagtatttttgtgaatcctgca
caattcggccctaatgaagattttgaagcatatccgcgcgatattgagcgggatgcagct
cttgcagaaaacgccggagtcgatattctttttacgccagatgctcatgatatgtatccc
ggtgaaaagaatgtcacgattcatgtagaaagacgcacagacgtgttatgcgggcgctca
agagaaggacattttgacggggtcgcgatcgtactgacgaagcttttcaatctagtcaag
ccgactcgtgcctatttcggtttaaaagatgcgcagcaggtagctgttgttgatgggtta
atcagcgacttcttcatggatattgaattggttcctgtcgatacggtcagagaggaagac
ggcttagccaaaagctctcgcaatgtatacttaacagctgaggaaagaaaagaagcgcct
aagctgtatcgggcccttcaaacaagtgcggaacttgtccaagccggtgaaagagatcct
gaagcggtgataaaagctgcaaaagatatcattgaaacgactagcggaaccatagactat
gtagagctttattcctatccggaactcgagcctgtgaatgaaattgctggaaagatgatt
ctcgctgttgcagttgctttttcaaaagcgcgtttaatagataatatcattattgatatt
cgagaaatggagagaatataa

DBGET integrated database retrieval system