KEGG   Bacillus subtilis subsp. subtilis 168: BSU22430
Entry
BSU22430          CDS       T00010                                 

Gene name
panB
Definition
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU22430 (panB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     BSU22430 (panB)
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase Asp_Glu_race
Other DBs
NCBI-GeneID: 939032
NCBI-ProteinID: NP_390124
Pasteur: BG11519
BSORF: BG11519
UniProt: P52996 A3F319
Position
complement(2353839..2354672)
AA seq 277 aa
MKTKLDFLKMKESEEPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTV
ADMIHHTKAVKRGAPNTFIVTDMPFMSYHLSKEDTLKNAAAIVQESGADALKLEGGEGVF
ESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQGKDEQSAKKLIEDSIKCEEAGAMMLVL
ECVPAELTAKIAETLSIPVIGIGAGVKADGQVLVYHDIIGHGVERTPKFVKQYTRIDETI
ETAISGYVQDVRHRAFPEQKHSFQMNQTVLDGLYGGK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaaacaaaactggattttctaaaaatgaaggagtctgaagaaccgattgtcatgctg
accgcttatgattatccggcagctaaacttgctgaacaagcgggagttgacatgatttta
gtcggtgattcacttggaatggtcgtcctcggccttgattcaactgtcggtgtgacagtt
gcggacatgatccatcatacaaaagccgttaaaaggggtgcgccgaatacctttattgtg
acagatatgccgtttatgtcttatcacctgtctaaggaagatacgctgaaaaatgcagcg
gctatcgttcaggaaagcggagctgacgcactgaagcttgagggcggagaaggcgtgttt
gaatccattcgcgcattgacgcttggaggcattccagtagtcagtcacttaggtttgaca
ccgcagtcagtcggcgtactgggcggctataaagtacagggcaaagacgaacaaagcgcc
aaaaaattaatagaagacagtataaaatgcgaagaagcaggagctatgatgcttgtgctg
gaatgtgtgccggcagaactcacagccaaaattgccgagacgctaagcataccggtcatt
ggaatcggggctggtgtgaaagcggacggacaagttctcgtttatcatgatattatcggc
cacggtgttgagagaacacctaaatttgtaaagcaatatacgcgcattgatgaaaccatc
gaaacagcaatcagcggatatgttcaggatgtaagacatcgtgctttccctgaacaaaag
cattcctttcaaatgaaccagacagtgcttgacggcttgtacgggggaaaataa

DBGET integrated database retrieval system