KEGG   Bacillus subtilis subsp. subtilis 168: BSU22440
Entry
BSU22440          CDS       T00010                                 

Gene name
birA
Definition
(RefSeq) bifunctional protein BirA
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU22440 (birA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU22440 (birA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     BSU22440 (birA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU22440 (birA)
SSDB
Motif
Pfam: BPL_LplA_LipB HTH_11 BPL_C BPL_LplA_LipB_2 HTH_24 Rrf2 HTH_23 HTH_36 Fe_dep_repress HTH_Crp_2
Other DBs
NCBI-GeneID: 939028
NCBI-ProteinID: NP_390125
Pasteur: BG11206
BSORF: BG11206
UniProt: P0CI75 A0A6M3ZD84
Position
complement(2354918..2355895)
AA seq 325 aa
MRSTLRKDLIELFSQAGNEFISGQKISDALGCSRTAVWKHIEELRKEGYEVEAVRRKGYR
LIKKPGKLSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTA
GRGRMSRVWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTDIKWP
NDILINGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEK
IDRAGVIQHILLCFEKRYRDYMTHGFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGI
DDEGVLLLETNEGIKKIYSADIELG
NT seq 978 nt   +upstreamnt  +downstreamnt
atgcggtcaacattaagaaaagaccttattgaattattttctcaggccggcaatgaattt
atttccggccaaaaaatcagtgatgctctcggctgttcaagaactgctgtgtggaagcat
attgaagagcttcggaaagagggttatgaagtagaagccgttagaagaaaaggatatcgg
ctcatcaaaaaacccggaaaactcagtgaaagcgaaattcgttttggattaaaaacggaa
gtgatgggccagcatcttatttaccatgacgttctttcaagcacgcaaaaaacggctcat
gagctcgcgaataataacgcaccggaaggcacccttgtggtggctgacaaacaaacagcc
ggaaggggccgaatgtctagggtatggcattctcaagaaggaaacggtgtttggatgagc
ctgattttgcggcctgacattccgctccaaaaaacaccgcagctgactctgcttgctgca
gtagctgttgtgcagggaatagaagaggcagcaggcatccaaacggatattaaatggcca
aatgatattttgattaacggaaaaaaaacagtcggtatcctaacggaaatgcaggctgaa
gaagaccgcgtacgttcagtgatcattgggatcggcattaacgttaaccagcagcctaat
gattttccagatgaattgaaggacatcgcgacaagcctcagccaagctgctggggaaaaa
attgatcgggccggcgtcatccagcatattttactatgctttgagaaacggtaccgggat
tatatgacgcacggatttacgccgattaagcttttatgggaaagctatgcgctcggtatt
ggcactaatatgagagccagaacgttaaacggaaccttttacggtaaggcgttaggtata
gatgatgaaggcgttctgcttttagaaacgaacgaaggcattaaaaaaatctattctgcc
gatatcgaattgggctaa

DBGET integrated database retrieval system