KEGG   Bacillus subtilis subsp. subtilis 168: BSU22450
Entry
BSU22450          CDS       T00010                                 

Symbol
cca
Name
(RefSeq) CCA-adding enzyme
  KO
K00974  tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU22450 (cca)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     BSU22450 (cca)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     BSU22450 (cca)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     BSU22450 (cca)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  3'processing and CCA adding factors
   CCA adding factors
    BSU22450 (cca)
 Prokaryotic type
    BSU22450 (cca)
SSDB
Motif
Pfam: PolyA_pol tRNA_NucTran2_2 PolyA_pol_RNAbd
Other DBs
NCBI-GeneID: 939025
NCBI-ProteinID: NP_390126
Pasteur: BG11208
BSORF: BG11208
UniProt: P42977 A0A6M4JK56
Position
complement(2355880..2357073)
AA seq 397 aa
MEKVFIKALPVLRILIEAGHQAYFVGGAVRDSYMKRTIGDVDIATDAAPDQVERLFQRTV
DVGKEHGTIIVLWEDETYEVTTFRTESDYVDFRRPSEVQFISSLEEDLKRRDLTINAMAM
TADGKVLDYFGGKKDIDQKVIRTVGKPEDRFQEDALRMLRAVRFMSQLGFTLSPETEEAI
AKEKSLLSHVSVERKTIEFEKLLQGRASRQALQTLIQTRLYEELPGFYHKRENLISTSEF
PFFSLTSREELWAALLINLGIVLKDAPLFLKAWKLPGKVIKEAIHIADTFGQSLDAMTMY
RAGKKALLSAAKISQLRQNEKLDEKKLKDIQYAYQNLPIKSLKDLDITGKDLLALRNRPA
GKWVSEELQWIEQAVVTGKLSNQKKHIEEWLKTCGQH
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggaaaaagtttttatcaaagcacttcccgtgctccgcatcttaatcgaagcgggccat
caggcttattttgtcgggggcgcagttcgtgacagctatatgaaacgaacgatcggagat
gtcgatatcgcgacagatgcggcacctgatcaagtagaacggctgtttcagcggactgtt
gatgtaggcaaagagcacgggaccattattgtgctctgggaggatgaaacctatgaagtc
acgacattccggactgaatctgattatgttgatttcagaagaccgtcagaagtgcaattt
atctcatcattagaagaggatctaaaacgcagagatttaacgatcaatgcgatggccatg
acagcggacgggaaggtgcttgattattttggcggcaagaaagatattgatcagaaagtg
attcgaaccgttggaaagcctgaggatagatttcaagaggatgcgcttcgtatgctgaga
gccgtacgctttatgagccagcttggctttacgctttcaccggaaacagaagaagccatt
gcgaaagaaaaatcactcctctcccatgtttcagtcgaacgaaaaactatagagtttgag
aaattgctgcagggaagagcttctcgccaggcgcttcaaacactcattcaaacgagattg
tatgaagagcttcctggtttttatcataaacgagaaaacctgatttcaacgagtgagttt
ccattcttctctttaacatcccgtgaggagctttgggctgctcttttaattaaccttggc
atagttttgaaagacgcgccccttttcctgaaagcctggaagctcccgggaaaagtgatc
aaggaagccattcacattgccgatacgtttggccagagccttgacgcaatgacaatgtac
agagctgggaaaaaagcactgctctcagcggccaaaatatcgcagcttcggcaaaacgaa
aaactggatgaaaagaaactgaaggacattcagtacgcttatcaaaacctgccgatcaaa
agccttaaggatcttgatatcacgggtaaggacttgcttgcgcttcgaaaccggccggcc
ggaaaatgggtgtcagaagaattacagtggatcgagcaggctgttgtgacagggaagctc
tccaatcaaaagaaacacatagaggagtggctgaagacatgcggtcaacattaa

DBGET integrated database retrieval system