KEGG   Bacillus subtilis subsp. subtilis 168: BSU22460
Entry
BSU22460          CDS       T00010                                 

Gene name
ypjH
Definition
(RefSeq) glycosyltransferase YpjH
  KO
K00754  L-malate glycosyltransferase [EC:2.4.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU22460 (ypjH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     BSU22460 (ypjH)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_2 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 Pyr_redox Cas_Cas1 Epimerase PFK GP67
Other DBs
NCBI-GeneID: 939029
NCBI-ProteinID: NP_390127
Pasteur: BG11213
BSORF: BG11213
UniProt: P42982 A0A6M3ZDL5
Structure
PDB: 
5D01 5D00

Position
complement(2357078..2358211)
AA seq 377 aa
MRKLKIGITCYPSVGGSGIIATELGKQLAEKGHEIHFITSSIPFRLNTYHPNIHFHEVEV
NQYAVFKYPPYDLTLASKIAEVAERENLDIIHAHYALPHAVCAYLAKQMLKRNIGIVTTL
HGTDITVLGYDPSLKDLIRFAIESSDRVTAVSSALAAETYDLIKPEKKIETIYNFIDERV
YLKKNTAAIKEKHGILPDEKVVIHVSNFRKVKRVQDVIRVFRNIAGKTKAKLLLVGDGPE
KSTACELIRKYGLEDQVLMLGNQDRVEDLYSISDLKLLLSEKESFGLVLLEAMACGVPCI
GTNIGGIPEVIKNNVSGFLVDVGDVTAATARAMSILEDEQLSNRFTKAAIEMLENEFSSK
KIVSQYEQIYADLAEPE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagaaaactaaaaataggaatcacatgctatccgagcgttggaggctcaggtatcatt
gcgacagaactggggaagcagcttgctgaaaagggacatgaaatccatttcatcacatca
agcattccgtttagactgaatacatatcatcccaatattcattttcatgaagttgaggtt
aatcaatatgctgtttttaagtatcctccgtatgatttgacattggcaagcaaaatcgct
gaggtggcggaacgggagaatttagacattatccatgctcactatgctctcccgcatgcc
gtttgcgcctatcttgcaaaacaaatgctgaaacgcaatatcggcattgttaccactttg
catggcacggatatcacggtgttaggttatgatccgtctctaaaagatctgatccgtttt
gctattgagtcatcagacagggtgacggccgtctcctcagcgcttgcggctgaaacatac
gatttaattaaaccggagaaaaaaattgaaacgatttataactttatagacgagcgcgtg
tatctgaagaaaaacacagcggcaattaaagagaaacatggaattttaccagatgaaaaa
gtcgtcatccatgtgtccaacttcagaaaagttaaacgcgtgcaggatgtcatccgtgtg
ttccgcaatatcgctggcaaaacgaaagcgaagctgcttttagtcggagacggtccggag
aaatcgacagcctgcgagcttatcagaaaatatggcttggaagaccaagtcttaatgctt
ggaaatcaagaccgtgttgaagatctttattctattagcgatttgaagctgctgctatct
gaaaaagaaagctttggccttgtcctgcttgaagcgatggcttgcggagtgccttgtatt
ggaacaaacattggcggtatccctgaggttataaaaaacaatgtgagcggatttttggtg
gatgtcggtgatgttacggccgcaacagcccgcgcgatgagcattttagaagatgaacag
ctaagcaatcgttttacaaaggcggcaatagagatgcttgaaaatgaattttcttctaaa
aaaattgtcagccagtatgaacagatttatgccgatttagcagaaccggagtga

DBGET integrated database retrieval system