KEGG   Bacillus subtilis subsp. subtilis 168: BSU22470
Entry
BSU22470          CDS       T00010                                 

Gene name
ypjG
Definition
(RefSeq) deacetylase YpjG
  KO
K01463  N-acetylglucosamine malate deacetylase 1 [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU22470 (ypjG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU22470 (ypjG)
SSDB
Motif
Pfam: PIG-L RE_NgoPII
Other DBs
NCBI-GeneID: 939026
NCBI-ProteinID: NP_390128
Pasteur: BG11212
BSORF: BG11212
UniProt: P42981 A0A6M4JIP5
Position
complement(2358208..2358918)
AA seq 236 aa
MYNADVLAFGAHSDDVEIGMGGTIAKFVKQEKKVMICDLTEAELSSNGTVSLRKEEAAEA
ARILGADKRIQLTLPDRGLIMSDQAIRSIVTVIRICRPKAVFMPYKKDRHPDHGNAAALV
EEAIFSAGIHKYKDEKSLPAHKVSKVYYYMINGFHQPDFVIDISDTIEAKKQSLNAYKSQ
FIPSKDSVSTPLTNGYIEIVEAREKLYGKEAGVEYAEGFFSKRMLMLDHDVLGGEQ
NT seq 711 nt   +upstreamnt  +downstreamnt
atgtataatgctgacgttcttgcttttggcgcccacagtgatgatgtcgagatcggaatg
ggcggcacaatagcgaagtttgtcaaacaggaaaaaaaagtaatgatatgcgatttgaca
gaagcggaactctcttctaacggtacggtcagtttgcgtaaagaagaagcagctgaagca
gcccgcatattaggcgcagataaaagaattcagctaacgcttccagaccgcggcctaata
atgagtgatcaggcaattcggtcaattgtcactgtcatcagaatctgtcggccaaaagcg
gtttttatgccgtataaaaaggatcgccatccggatcacggcaatgcggctgcactggtg
gaagaagcgatcttttccgccggaatccataaatataaagacgaaaaaagccttccggcg
cataaagtcagcaaggtttactattatatgataaatggttttcatcagccggattttgtt
attgatatctcggatacaatagaggcaaagaaacaaagcctcaacgcctacaaaagccag
tttatcccgtcaaaggattccgtttctactcctctgacgaatgggtatattgaaatcgtt
gaagcgagagaaaagctttacggtaaagaagcgggcgtggagtatgccgaaggtttcttt
tccaaacggatgctgatgcttgatcatgatgtgcttgggggcgaacaatga

DBGET integrated database retrieval system