KEGG   Bacillus subtilis subsp. subtilis 168: BSU22480
Entry
BSU22480          CDS       T00010                                 

Gene name
mgsA
Definition
(RefSeq) methylglyoxal synthase
  KO
K01734  methylglyoxal synthase [EC:4.2.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU22480 (mgsA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.3  methylglyoxal synthase
     BSU22480 (mgsA)
SSDB
Motif
Pfam: MGS
Other DBs
NCBI-GeneID: 939027
NCBI-ProteinID: NP_390129
Pasteur: BG11211
BSORF: BG11211
UniProt: P42980 A0A6M4JNJ8
Structure
PDB: 
6F2C

Position
complement(2358911..2359324)
AA seq 137 aa
MKIALIAHDKKKQDMVQFTTAYRDILKNHDLYATGTTGLKIHEATGLQIERFQSGPLGGD
QQIGALIAANALDLVIFLRDPLTAQPHEPDVSALIRLCDVYSIPLATNMGTAEILVRTLD
EGVFEFRDLLRGEEPNV
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaaattgctttgatcgcgcatgacaagaaaaaacaggatatggttcaatttacgact
gcctatcgggatattttaaagaatcatgatctatacgcaaccggaaccacagggttgaaa
attcatgaggcgacaggtcttcaaattgaacgttttcaatccggccctttagggggagac
cagcaaatcggtgcactgatcgctgccaatgcactcgatcttgtcatttttttgcgcgac
ccgctgaccgcgcagccgcatgaaccggatgtctcggcattaatccgtttatgtgatgtg
tattccattccgctcgccacaaatatgggtactgcggaaattcttgtgcgcacacttgat
gaaggtgttttcgaattccgtgaccttcttcggggagaagagccgaatgtataa

DBGET integrated database retrieval system