KEGG   Bacillus subtilis subsp. subtilis 168: BSU22490
Entry
BSU22490          CDS       T00010                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00261  Monobactam biosynthesis
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU22490 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU22490 (dapB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     BSU22490 (dapB)
SSDB
Motif
Pfam: DapB_C DapB_N GFO_IDH_MocA Semialdhyde_dh NAD_binding_3 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 939024
NCBI-ProteinID: NP_390130
Pasteur: BG11207
BSORF: BG11207
UniProt: P42976 A0A6M4JN90
Position
complement(2359340..2360143)
AA seq 267 aa
MSNETIKLVIAGPRGRMGQEAVKLAERTPHFDLVGAIDHTYDQQKLSDVMPVESDAFIYT
DIHACFTETQPDVLIDLTTPEIGKVHTKIALEHGVRPVVGTTGFSEADLKELTSLTEEKG
IGAIIAPNFALGAILMMKFSKMAANYFEDVEIIELHHDQKLDAPSGTALKTAEMISEVRK
EKQQGHPDEKEILPGARGAEQNGIRLHSVRLPGLIAHQEVMFGMDGQTLQIRHDSYNRAS
FMSGVKLSVEQVMKIDQLVYGLENIID
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcaaacgaaacaattaaattagtcattgcgggaccgcgtggaagaatggggcaggaa
gctgttaaattggcagaacgaacaccacattttgaccttgtaggggccatagaccataca
tacgatcagcaaaaattatctgatgtgatgcctgttgagtcagatgctttcatttacaca
gatatccatgcctgttttacagaaacacaaccggatgtcttgattgatttaacaacgccc
gaaatcggaaaagtacatacaaaaattgcattagagcacggagtccgtccagttgtcgga
acaaccggtttctcagaagctgatttaaaagagctcacatctttaacagaagaaaaaggg
atcggagccatcatcgcgccaaattttgcgctcggtgcgatactgatgatgaaattttca
aaaatggctgccaactattttgaggatgttgagattattgagcttcatcatgaccagaag
cttgacgcaccaagcggaactgcgcttaaaacagcggaaatgatttcagaagtccgtaaa
gaaaagcagcaaggacatccggatgaaaaagaaattctcccaggagcaagaggagcggag
caaaacggtattcgcttgcacagcgtccgtcttccgggactgatcgcgcatcaggaggtc
atgttcggcatggatggccaaacgcttcagatacgccatgattcttataaccgtgcttct
ttcatgtcaggcgttaaactgtcagtcgaacaagtcatgaagattgatcagcttgtgtat
ggtttagaaaatatcattgattag

DBGET integrated database retrieval system