KEGG   Bacillus subtilis subsp. subtilis 168: BSU22500
Entry
BSU22500          CDS       T00010                                 

Gene name
ypjD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MazG MazG-like dUTPase_2 PRA-PH MobL Dynamitin
Other DBs
NCBI-GeneID: 939022
NCBI-ProteinID: NP_390131
Pasteur: BG11210
BSORF: BG11210
UniProt: P42979 A0A6M3ZGP4
Structure
PDB: 
2GTA

Position
complement(2360155..2360490)
AA seq 111 aa
MSDKTMKDIQAEVDRYIGQFKEGYFSPLAMMARLTEELGELAREVNHRYGEKPKKATEDD
KSMEEEIGDVLFVLVCLANSLDISLEEAHDRVMHKFNTRDKDRWTRKEEGK
NT seq 336 nt   +upstreamnt  +downstreamnt
gtgagtgataaaacaatgaaagacatacaggctgaagtagaccgttacataggccaattt
aaagaaggatattttagcccgctggccatgatggcgaggctgactgaagaactgggcgag
cttgccagagaagtgaatcaccgttatggagaaaaaccaaaaaaagcgactgaagatgat
aaaagcatggaagaggaaataggcgatgtgctatttgtattggtttgtttagccaactct
cttgatatctctttagaggaagctcacgaccgagtcatgcataaatttaatacaagagat
aaagatcgctggaccagaaaagaagaaggaaagtag

DBGET integrated database retrieval system